KEGG   Gloeobacter violaceus: gll2569Help
Entry
gll2569           CDS       T00148                                 

Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00010  Glycolysis / Gluconeogenesis
gvi00020  Citrate cycle (TCA cycle)
gvi00620  Pyruvate metabolism
gvi01100  Metabolic pathways
gvi01110  Biosynthesis of secondary metabolites
gvi01120  Microbial metabolism in diverse environments
gvi01130  Biosynthesis of antibiotics
gvi01200  Carbon metabolism
Module
gvi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gll2569
   00020 Citrate cycle (TCA cycle)
    gll2569
   00620 Pyruvate metabolism
    gll2569
Enzymes [BR:gvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     gll2569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL
Motif
Other DBs
NCBI-GeneID: 2600970
NCBI-ProteinID: NP_925515
CYORF: gll2569
UniProt: Q7NHG8
Position
complement(2719813..2721072)
Genome map
AA seq 419 aa AA seqDB search
MIREVTMPALSSTMTEGKIVTWKKQEGDAVSRSDILLVVESDKADMDVESFDEGILANIL
VSDGGSAPVGSVIALIAETEAEVAEAKKRPPSGTAAAPPATVPTPAPAPSAPAPVAAATT
PVSSGSNGGRIVASPNARRLAEQLGVDLASITGSGPGGRIVGEDVERAAAGAKAPAPAPA
AKPASAPAPLPAAAASGQPVAFSALQQAVNRNMEAALAIPAFRVGYTITTDAFDELHKSV
KSKGVTVTTMLVKAVAITLAKHPLLFAAYTESGLRYHSAVNVAVAVAMEEGGLITPVLRA
ADSKDLYTLAREWKDLVERARLKKLQPEEYTSGNFTLSNLGMFGVDRFDAIVPPGTSAIL
AIGAAKPTVVVTEAGHIAIQKQMQVNLSGDHRVFYGTDGARFLQDLAKLIEQSPQQLTL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcgaagtcacgatgcccgccctgtcctcgacgatgaccgagggcaagatcgtc
acctggaagaagcaggagggagatgcggtcagccgcagcgacatcctgctggtcgtcgag
tccgacaaggcggacatggatgtcgagtcttttgacgagggcatcctcgcgaacatcctg
gtaagcgacggcggcagcgccccggtaggctcggtgatcgccctgattgccgagaccgag
gcggaggtggcagaggcaaaaaaacggcccccaagcggcactgccgccgcaccacctgcg
acggttcccaccccggcaccggcgccgagtgctcctgccccggtggcggccgccacaact
ccagtctcctccggcagcaacggcggccggatcgtcgcttctcccaacgcccgccgcctc
gctgaacaactgggggtggatctggcgagcatcacgggcagcggtcccggtggccggatc
gtgggtgaagatgtcgagcgcgctgcggcaggcgccaaggctccggcccccgcccccgcc
gccaaaccggcgtccgcccctgccccgctcccggctgcggcggcgagcggtcagccggtg
gccttcagcgccctgcagcaggcggtcaaccgtaacatggaagcggccctggccatcccg
gcttttcgggtcggttatacgatcacgaccgatgctttcgacgaactgcacaagtcggtc
aaatcgaagggcgtgacggtgaccacgatgctggtgaaggccgtggccattaccctcgcc
aagcacccgctgctgtttgccgcctacaccgaatccggcctccgctaccattcggcggtc
aatgtcgcagtggcggtggcgatggaggagggggggctgatcaccccggtgctgcgcgcc
gccgacagcaaagatctctataccctggcgcgcgagtggaaagatctggtggagcgcgcc
cgcctcaagaagctgcagccggaggagtacacgagcggcaacttcaccctgtcgaatctg
ggcatgttcggggtcgaccgcttcgatgccattgtgccccccggcaccagcgccattctg
gctatcggtgccgccaaaccgacggtggtagttaccgaggcgggccacatcgccattcaa
aaacagatgcaagtcaacttgagcggcgaccaccgggtcttctacggcaccgacggggcg
cgcttcctgcaggatctggccaagctcatcgagcaatcgccgcagcagttgacgctttga

DBGET integrated database retrieval system