KEGG   Gloeobacter violaceus: gll2836Help
Entry
gll2836           CDS       T00148                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00010  Glycolysis / Gluconeogenesis
gvi00071  Fatty acid degradation
gvi00350  Tyrosine metabolism
gvi00625  Chloroalkane and chloroalkene degradation
gvi00626  Naphthalene degradation
gvi01100  Metabolic pathways
gvi01110  Biosynthesis of secondary metabolites
gvi01120  Microbial metabolism in diverse environments
gvi01130  Biosynthesis of antibiotics
gvi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gll2836
  Lipid metabolism
   00071 Fatty acid degradation
    gll2836
  Amino acid metabolism
   00350 Tyrosine metabolism
    gll2836
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    gll2836
   00626 Naphthalene degradation
    gll2836
Enzymes [BR:gvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     gll2836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 2601237
NCBI-ProteinID: NP_925782
CYORF: gll2836
UniProt: Q7NCZ0
Position
complement(3022041..3023033)
Genome map
AA seq 330 aa AA seqDB search
MKAAVVPNLHGRWEIRDLPIPEPGINQVLIRIKASGLCYTDIHITEGAWPADSFPRTLGH
EPVGEIVALGAGVRTRRLGDRVGVPWLQLACGRCEWCRRGKALFCKDQQGTGVQTQGGHA
EYMLAQAEATVLLPDALAYEQAASLFCAGYTVWAGLRFADPKPHERVAVLGIGGLGHLAV
QYGKAAGFETFAITHSPSKEKLVRSLGADGVFPSGAALREAGGADVILACSNSYRATGEA
LQGLRPDGRLVLMGLPSDNQTLAVSGDLLVNRWRIIGSQQNGPEHLFEALDYAAKGKVKV
VAETYSLDEINLAFDRVFSGDVRFRAVIIP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgtcgttccgaacctgcacggccgttgggaaatccgcgatctgccgatt
cccgaacctgggatcaaccaggtactcatccggatcaaagcgagcggcctgtgctacacc
gacattcacatcaccgaaggagcctggcccgcggacagcttcccgcgtaccctcggccat
gaaccagtgggcgaaattgtcgccctcggtgccggagtacgcacgcgtcgcctgggcgat
cgcgtcggagtgccgtggctgcagctggcctgcgggcggtgcgaatggtgtcggcgcggc
aaagcgctcttttgcaaagatcaacagggcacgggcgtgcagacccagggcggccacgcc
gaatatatgcttgcccaggccgaagcgaccgtgctgttacctgacgccctcgcttacgaa
caggcggcttcgctattttgcgcgggctacaccgtctgggcggggctgcgctttgccgac
ccgaaaccccacgagcgcgtcgcagtattgggcatcggcggtcttgggcacctggcggtt
cagtacggcaaggcggcgggcttcgaaactttcgccatcacccactcgccttcgaaagaa
aaactggtgcgctcgctcggggctgacggggtgtttccctccggggccgcgctgcgggag
gcggggggggccgatgtgatcctcgcctgcagcaactcgtatcgggcgaccggcgaagct
ttgcaagggctgcgcccggacggccggttggtgctgatgggtcttcccagcgacaaccag
accctcgcggtgagtggcgatctgctggtcaaccgctggcggatcatcggttcgcagcaa
aacggcccggagcaccttttcgaagccctcgactacgcggctaaaggcaaggtcaaagtc
gttgccgagacctactcgctcgatgaaatcaaccttgctttcgaccgggtcttcagcggt
gatgtgcgctttcgcgccgtgatcatcccctaa

DBGET integrated database retrieval system