KEGG   Gloeobacter violaceus: gll2991Help
Entry
gll2991           CDS       T00148                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
gvi  Gloeobacter violaceus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    gll2991
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    gll2991
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    gll2991
Enzymes [BR:gvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     gll2991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
complement(3191238..3192881)
Genome map
AA seq 547 aa AA seqDB search
MFNRRTVIKGALVAPALLLSVNPRRRAAAQGADDYGVASGDPRSDGVVLWTRVPEAFQNG
GPLTVHFEVSLTEDFASVVLQGSVTTDAGHDFTVKMRTGGLEPFTRYYYRFTTDTGYTSV
TGRTKTAPDPDSSIEQLTFAYVSCQDYTQGFYTVYAAICQDDDADYCIHLGDNIYETGDA
GFQNGQVREDTIGGGEARTLEEYRAKYKLYLSDPDFREVRRLFCWIHLWDDHEVFNNYAG
RDLVSEEQKARQLAGYTAFLEYLPVEPVTPLTVVDDKAVVRLYRKLSFGALADLFVLDLR
QFRDGVVCASDFLSPGCPELEDPARTMLGYQQRSWLKKNLLGSQARWKVLLNEMMLVRFV
AFDIGTDGRPTGKPPRFFGRPRRVEGDIVSEANGLTLYINLDAWDGYPAERTELLSFIAD
KQIRNVVVWTGDIHNCYAGVLKPDFTDPASPSVAVEVVGGSVSSAGVFELLGGLIDPTPL
AAPLLQQSNPYIEYVDLKYHVYTKAVLTRESMQVSYRAVETITETVSASFTLQSFTIPDG
ESQLLPS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatcgtcgcacggtaatcaaaggcgccttggtcgccccggcgctgttgctgtcc
gtcaatccgaggcgccgggccgccgcccagggtgccgacgattacggcgtcgcctcgggc
gatccgcgctccgatggggtggtgctctggacgcgggtgccggaagcgtttcagaacggc
ggaccgctgacggtccatttcgaagtctcgctgacggaggattttgcctccgtggttctc
cagggcagcgtcaccacggacgccggtcacgacttcaccgtcaagatgcgcaccggcggc
ctggagccttttacgcgctactattaccggttcaccaccgatactggctacaccagcgtc
acaggccgcaccaagactgcccccgaccccgacagcagcatcgaacaactgacctttgcc
tacgtctcctgccaggattacacccagggcttctacacggtctatgccgccatttgccag
gatgacgacgccgactactgcattcacctgggcgacaacatttacgagacgggtgatgcg
ggcttccagaacggccaggtgcgcgaggacacgattggcggcggtgaggcgaggaccctc
gaagagtaccgcgccaagtacaagctctacttgagcgatcccgactttcgcgaggtgcgc
cgtctgttctgctggatccacctgtgggacgaccacgaggtgttcaacaattacgccggg
cgcgacctggtgagcgaggagcaaaaggcgcgccaactggcgggctacacggcctttcta
gagtacctaccggtcgagccggtcactccccttacggtcgtggacgacaaggcggtggtg
cggctctaccgcaagctctcgtttggcgctcttgcggatttgttcgtgctcgacttgcgc
cagtttcgcgacggtgtggtctgcgccagcgactttttgagccccggctgccccgaactc
gaagatccggcgcgcacgatgctgggctatcagcagcgcagttggctcaagaaaaatttg
ctcggttcacaggcgcgctggaaggtgcttcttaacgaaatgatgctggtgcgcttcgtg
gcgttcgacatcggtacggacggtcggcccacgggtaagccgccgcgctttttcggccgc
ccgcgccgcgtggagggcgatatcgtctccgaggcgaatgggctgacgctctacatcaac
ctggatgcctgggacggctatcctgccgagcgcaccgagctgctttcgtttattgccgac
aagcaaatccgcaacgtcgtggtctggaccggcgatatccacaactgctacgcgggcgtc
ctcaagcccgatttcaccgatccggcgagcccgtcggtggcggtggaggtggtgggcggc
tcggtcagttcggcgggcgtcttcgagctgttgggcggcctcatcgatccgacgccattg
gcagctccgctgttgcagcagtccaatccgtatatcgagtacgtcgatctcaagtaccac
gtctacaccaaggcggtgttgacgcgcgaatcgatgcaggtgagctaccgggcggtcgag
acgatcaccgagacggtctcggcgagttttaccctgcagtcgttcaccatccccgacggc
gaatcacaactgttgcccagttga

DBGET integrated database retrieval system