KEGG   Gloeobacter violaceus: gll3316Help
Entry
gll3316           CDS       T00148                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gvi  Gloeobacter violaceus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    gll3316
Enzymes [BR:gvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     gll3316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
complement(3514287..3515801)
Genome map
AA seq 504 aa AA seqDB search
MLLPRASGILLHPTSLPGPYGIGSLGSEAREFIDLMAITGQRFWQILPLAPTGYGNCPYM
SCSAFAGNPLLVDPEDLVAQALIDKDDLAPDELKTTAGWHHPKINFEEAVAYKTRLLETA
CENFAAKGDSDKKLFWAYCEREGWWLDDYALFMALKEANDTLPWQEWDQGLALREGAVLK
QQSRELRDRVFYHQFSQYLFSRQWSALKQYANGRGVSILGDLPIYVAADSADVWAHPHLF
QLDESGNPTVVAGVPPDYFSATGQLWGNPIYDWEAMERNGYAWWINRIKRMLDMVDLVRI
DHFRGFASYWEVEAGRTTAIDGRWIKGPGPQLFDAIEKALGSLPVVAEDLGVLTDEVETL
RDRYGLFGMKVLQFAFDGMANNIHLPHNHVRSSIVYTGTHDNDTTVGWYNHSPRWVHEAT
ERYLYLNTGWEIHWALVRCALASVCNLSILPMQDVLGLGSEARMNTPGVAEGNWDWRVGT
FEAVEPWMRERLADLTALYGRWSG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgctgcttcctagagcgagtggaatcctcctgcacccgaccagcctgccgggtccctac
gggatcggcagtttgggcagcgaggcccgtgaatttatcgacctgatggcgatcaccggc
cagcgcttctggcagatcttgccgctggcaccgaccggctacggcaactgcccctatatg
tcctgctcggcttttgcaggaaacccactgctggtggacccggaggatctggtggcgcag
gcactcatcgacaaagacgacctggcaccggacgagctgaagacgaccgccggctggcac
cacccgaagatcaacttcgaggaggccgtcgcctacaagacgcgcttactcgagaccgcc
tgcgaaaattttgccgccaaaggcgacagcgacaaaaaactcttttgggcctactgcgag
cgcgagggctggtggctcgacgattacgccctgttcatggcgctcaaagaagccaacgac
actctgccctggcaggagtgggaccagggattggcgttgcgcgagggggcggtcctcaag
cagcagtcgcgcgagttgcgcgaccgggtgttctatcaccagttcagccagtatctattt
tcccggcagtggagtgccctcaaacagtacgccaacggccgcggcgtgagcatcctgggg
gatctgcccatttatgtcgccgccgacagcgccgatgtctgggcgcacccgcatctgttt
cagctcgacgagagcggcaatccgacggtggtggccggggtgccgcccgattacttcagc
gccaccggccagttgtggggcaaccccatctacgactgggaggcgatggagcgcaacggc
tacgcctggtggatcaaccgcatcaagcgcatgctcgacatggtggacctggtgcgcatc
gaccactttcgcggtttcgcatcgtactgggaagtggaggcgggccggacgacggccatc
gacggccgctggatcaaaggccccggcccacaactgttcgatgcgatcgaaaaggccctg
ggcagcctaccggtggtggcggaggatctgggggtgctcaccgacgaggtcgaaacactg
cgggatcgctatgggctgttcggcatgaaggtgctgcagtttgccttcgacggcatggcc
aacaacatccacctgccccacaaccacgtgcgcagttccatcgtctacaccggcacccac
gacaacgatacgaccgtgggctggtacaaccactcgccgcgctgggtgcacgaggcgacc
gagcgctatctctacctcaataccggctgggaaatccactgggcgttggtgcgctgcgcc
cttgcctcggtgtgcaatctgtcgatcttaccgatgcaggatgtcctgggtctgggcagc
gaggcgcgcatgaacactcccggggtagcggagggcaactgggactggcgggtcggcacc
ttcgaggcggtcgaaccctggatgcgcgagcgtctggcggatttgacggctctttacggt
cgttggtcgggctga

DBGET integrated database retrieval system