KEGG   Gloeobacter violaceus: gll3725Help
Entry
gll3725           CDS       T00148                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gvi  Gloeobacter violaceus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    gll3725
Enzymes [BR:gvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     gll3725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
complement(3937273..3938118)
Genome map
AA seq 281 aa AA seqDB search
MVQASAARRAKVVLIPVVSEGGPEAAQGIQAVLEASLVIEAFDEELRADPFAVGIDAMRA
FWDEPPFANAEQAVGIVLDHRQFALVLAGERTLSLGAVRAAWKRHRDLAVVQVAAHAQLR
SEVEGDPYGPWCLAARLGDWGLPVVQVGVRSLSRAEWDWYEAQGQDRHRIFWSRQFRAHC
PEAQSWDVPEVLAAIEPERPLYLSIDIGGLDAPMAAMAEHPEPGGLGWFALLRLLRALFE
RHAVVACDLSGFGAEASPAASAPLARLLHKIVGYKFYGGRG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggtccaggcgagtgccgcgcgccgggcgaaagtggtgttgatcccggtggtttctgag
ggagggccggaggcagcccagggtatccaggctgtgctggaggccagcctggtcatcgaa
gcattcgatgaagaattgcgcgccgatccgttcgcggtcggcatcgatgcgatgcgcgcc
ttttgggacgagccgccctttgccaatgccgagcaggcggtcgggattgtgctcgaccac
cgacagtttgccctagtgctggcgggggagcgcaccctcagcctcggagcggtgcgggcc
gcctggaagcgccaccgcgatctggccgtggtgcaggtggccgcccacgcccaactgcgc
agcgaggtcgaaggcgatccctacggcccctggtgcctggcggcccgactcggagactgg
gggttgccggtggtgcaggtgggggtccgctccctcagccgtgcggaatgggattggtac
gaagcccagggccaggatcgccaccgcatcttctggtcccggcaatttcgcgcccactgc
ccggaggcccaaagttgggatgtgcccgaagtgctcgcagcgattgaacccgaacgcccg
ctctatttgagcatcgacatcggcggcctcgacgctccgatggcggcgatggccgagcac
cccgagcccggcggactgggttggttcgcgctgctgcggcttttgcgcgcgcttttcgag
cgccacgcagtggtggcctgcgacctgagcggctttggcgccgaggcttccccggccgcc
agtgcccccctcgcccgtctgttgcacaagatcgtcggctacaagttttacggcggccga
ggctga

DBGET integrated database retrieval system