KEGG   Gloeobacter violaceus: gll3736Help
Entry
gll3736           CDS       T00148                                 

Definition
(RefSeq) two-component sensor histidine kinase
Organism
gvi  Gloeobacter violaceus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CYORF: 
UniProt: 
Position
complement(3946195..3948927)
Genome map
AA seq 910 aa AA seqDB search
MDGVVSVMKRAATGKFIQHWAGECKQRVNLSLTATAWERLRRQAAERGISRSEIVEQFAR
AEEPDDSSLERRVLDLERQNEQLRRELEQARGEAAERHRVETALCRSEARFRQLVAENLI
AIGFGDCAGMIVEANDAFLQLVGYNREELAAGRVRWAQMTPPEYRERDEQAMAELASTGA
CRPYEKEYIHKDGRRVPILIGATLLEGGERVACFVFDLGGHRRARADLERANERFQLAAK
AAGCLVYDWDLEANRVEHAYGLLELLGYNAEEISEPAHLWWAEQIHPDDRERANAEVWAA
LQDAEMPNYAIEYRVRNRQGHHINVCDRGVVRRAPDGRAIRVVGCTLDLSESKNLEARVR
STDEHYRFLAESIPQIVWTARPDGALDYYNRRWYDYTGLTPQQSEGWGWQPVLHPEDLDR
CLKYWRQAVATGSSYEIEYRFRRAGDGAYRWHLGRALPMRDREGQIVKWFGTSTDIDDQK
RAAAELAAREQAQRFLAEAASILASSLDYTVTLDRVAQLTVPLLADWCSVDMVSEDGGIE
KLVIAHVDAQKALQIRELQRRYPFDPREASGVANVLRTGRSEFYPKITDELLIAIARSPE
HLELLRKAGFSAALLVPLTARGRTFGAITLVMSDSGRRYGRTDLALAEDLACHAAIAIDN
ARLYHQAWEANRIKDEFLATVSHELRTPLNAILGWTQILRRRKLDAESQARALETIERNG
RAQNQLIEDILDVSRIITGKLKLDVRPLDLAAVIEEALDSVCLASEAKHIALHCTLDAEA
ASVSGDPARLQQVVWNLLSNAIKFTPEGGRIDVRLAADGASALLSVRDSGVGITPEALPY
IFERFRQADGSNTRAFGGLGLGLAIVRHLVELHGGTVTAHSDGPGRGALFAVRLPRRRPG
GDRAEGGLAA
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtggacggcgtagtgagcgtcatgaagcgcgcagcgacgggcaaatttatccaacactgg
gccggggagtgcaagcaacgggtgaatctatcgctcacggcgaccgcctgggaacggttg
cggcggcaggcggcggagcgcgggatctcgcgctcggagattgtcgagcaatttgcccgc
gctgaggagccggacgattcgagtttggagcggcgggttctggatctggagcggcagaac
gagcaattgcgtcgcgaactggagcaggcccgcggcgaagccgccgagcgccaccgggtg
gagaccgccttgtgccgcagcgaggcgcgctttcggcagctggtcgcggagaatctgatt
gccatcggctttggagactgcgcaggaatgatcgtcgaggccaacgacgcttttttgcaa
ttggtgggctacaaccgcgaagaactggcggcgggccgggtgcgttgggcgcagatgacc
ccgccggagtatcgcgagcgcgacgagcaggccatggccgaactggcgagcaccggcgcg
tgtcggccctacgagaaggagtacatccacaaagacggacgccgtgtaccgattctcatc
ggtgccacgctgcttgaaggcggagagagggtcgcctgctttgtcttcgatctgggagga
caccggcgcgcccgggcggacctggagcgggcgaatgaacggtttcaactggcggcgaag
gcggcgggctgtttggtttacgactgggatctcgaggcgaaccgcgtcgagcacgcctac
ggtctgctcgagctgctgggctacaacgccgaggaaatcagcgaacctgcccacctctgg
tgggcggagcagattcatcccgacgaccgggagcgcgccaacgcagaagtctgggctgct
cttcaagacgcggaaatgccgaactacgccatcgagtaccgggtccgcaatcgccagggc
caccacatcaacgtttgcgaccgcggcgttgtccgccgcgcccccgacggccgggccatc
cgggtggtgggctgcaccctcgacctcagcgaatcgaaaaatctcgaagcgcgcgtgcgc
agcaccgatgaacattatcgttttctggccgagtcgattccgcagatcgtctggactgcc
cggcccgacggtgccctcgactactacaaccggcgctggtacgactacacgggcctcacc
ccccagcagagcgagggctgggggtggcagccggtactgcacccggaagatctagatcgc
tgtctgaaatactggcggcaggcagtggccaccggtagctcctacgagatcgaataccgc
tttcggcgggcgggcgacggcgcttaccgctggcacctgggccgggcgttgccgatgcgc
gaccgcgaaggacagatcgtcaagtggttcggcacctccaccgacatcgacgatcaaaag
cgggcggcagccgaattagccgcccgcgagcaggcccagcgctttttggcggaggccgcc
tcgattctggcttcctcgctcgattacaccgtgacgctcgatcgcgtagcccagttgacg
gtgccgctgctggccgactggtgctcggtggacatggtgtccgaagacggcggcatcgaa
aagttggtcatcgcccacgtcgatgcccaaaaagcgctccagatccgtgagttgcagcga
cgctaccccttcgacccgcgggaggcaagcggggtcgccaatgtcctgcgcactgggcgt
tcggaattctacccgaaaattaccgacgaactgctcatcgccatcgcccgcagcccggag
catctggagctgttgcgcaaagccggcttcagcgcggcgctgctggtgccgctgaccgcc
cgcggccgcaccttcggcgctatcaccctggtgatgtccgactccggacgccgctacggc
cggacggatctggccctagccgaagacctggcctgccacgcggccatcgccatcgacaat
gcccggctctaccatcaggcctgggaggccaaccggatcaaagacgagtttctggccacc
gtcagccacgaactgcgcaccccgctcaacgccattttgggctggacccaaatcctccgg
cggcgcaagctcgatgccgagtcccaggcgcgggcgcttgagaccatcgagcgcaacggc
cgggctcaaaaccagctcatcgaagacatcctcgatgtctcgcggatcattaccggcaag
ctcaagctcgacgtgcgaccgctcgatctcgcggcggtgatcgaggaagccctcgactcg
gtgtgcctggcctcggaggccaagcacattgccctgcactgcaccctcgatgctgaagcg
gcctcggttagcggcgacccggcccggctgcagcaggtggtctggaatctgctgtccaat
gcgatcaaattcacccccgagggcggtcgcatcgacgtgcgcctcgcagccgacggcgcc
agtgcgctgctcagtgtgcgcgacagcggcgtggggattacccctgaagctttgccctac
atctttgagcgcttccgccaggccgacggctccaacacccgtgccttcggcggtcttgga
ctgggtctggcgatcgtgcgccacctggtcgaactgcacggcggcaccgtcaccgcccac
agcgacggccccggccggggggctttatttgctgtccgcctgccccggcggcggccgggc
ggggatcgcgccgagggtggccttgcggcctaa

DBGET integrated database retrieval system