KEGG   Gloeobacter violaceus: gll4111Help
Entry
gll4111           CDS       T00148                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
gvi  Gloeobacter violaceus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    gll4111
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gll4111
  Lipid metabolism
   00071 Fatty acid degradation
    gll4111
  Amino acid metabolism
   00350 Tyrosine metabolism
    gll4111
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    gll4111
   00626 Naphthalene degradation
    gll4111
Enzymes [BR:gvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     gll4111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
complement(4306802..4307821)
Genome map
AA seq 339 aa AA seqDB search
MTKMRAMIVPEAGAKFQMIERDLPVPGPREVRLSVSACGVCHSDSVTVEGTMRGIAYPRV
PGHEVIGTIEALGPEVLGWEVSMRVGVGWFGGSCGYCAHCRRGSAFACETVSAVTGVTRD
GGYATHMLADVSALAHVPTDLDVVESAPLLCAGITTFNALRNCGAGPGELVAIHGIGGLG
HLGIQFAARQGFRTVAVNRGRDKEELARSLGAHEYIDSEEGDPAAALLAMGGAKAILATV
TSEKAMQALVGGLGPNGTMMLIGAVPTLTVNPTELLLKRAAVKGWYSGTAADSEDTLLFS
HRNGITSMNEIYPFENAQAAYDRMMSGKARFRVVLSMGV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgactaagatgcgcgccatgatcgtacctgaagcgggcgcgaagtttcagatgatcgag
cgggatttgcccgtacccgggccgcgggaggtccggctgagcgtcagcgcctgtggcgtg
tgtcacagcgactctgtgacggtcgaagggacgatgcggggcatcgcctatccgcgcgtg
cccggccatgaggtgatcggcacgatcgaggcgctcgggccagaggtgctcggctgggag
gtgagcatgcgcgtcggcgtcggttggttcggcggctcgtgtgggtattgcgcgcactgc
cgacgcggctcggcgttcgcctgcgagacggtgagcgccgtcaccggtgtgacccgcgac
ggcggctacgcgacccacatgctggccgatgtctccgcgctcgcccatgtgccgaccgat
ctcgacgtggtcgaatcggcgcccttactgtgtgccggtatcaccaccttcaacgcgctg
cgcaattgcggtgcggggccgggcgagttggtggcgatccacggtatcggcgggctcggt
catctcggtatccagttcgccgcgcgccagggcttccgcaccgtcgccgtcaaccgcggc
cgcgacaaagaggaactcgcacgctcgctcggcgcgcacgaatacatcgacagcgaagag
ggcgatcccgccgccgcactgctggcgatgggcggggcaaaggcgatcctcgcaaccgtc
accagcgagaaagcgatgcaggcgctcgttggcggtctcggacccaacggcacgatgatg
ctcatcggtgcagtgcccaccctcactgtcaacccgacagagttactcctcaagcgcgcc
gcggtgaagggctggtattcgggcacggcggccgattcggaggatacactgctgtttagc
catcgcaacgggatcacctccatgaacgaaatctacccgttcgagaacgcacaggctgca
tacgatcggatgatgagcggcaaggcgcgctttcgcgtcgtcctttcgatgggggtgtaa

DBGET integrated database retrieval system