KEGG   Gloeobacter violaceus: glr0373Help
Entry
glr0373           CDS       T00148                                 

Definition
cyclomaltodextrin glucanotransferase
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
gvi  Gloeobacter violaceus
Brite
Enzymes [BR:gvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.19  cyclomaltodextrin glucanotransferase
     glr0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
387592..389520
Genome map
AA seq 642 aa AA seqDB search
MFRGYALSLYSRGIKGDPMDTQKIGEVEPHSQIEVQEKEDEFVNLLQLSDIEFRGETIYF
IVVDRFFNGDPDNDDGPDPSLYDPERQDWGKYWGGDLQGIIEKLDYLQQLGVTAVWVTPL
FEQVEAMAWEAAPIHGYWTRDFKRINPRWVAGEHEVRLFERNDTTFDRLIEALHKRGMKL
VLDIVCNHSSPDAGGIKGQLFDDGKLIADYNDDKDHWYHHYGEVNNWDDEWQVQNCDLAG
LATFNENNVRYRNYIKGAIKLWLDKGVDALRVDTVKHMPIWFWQEFNSDIQAHKPDVFVF
GEWIYSHPLGERPVEFANYSGMTILDFGLCVAIRKALGQGGVGGFHLIEDVFKEDWRYRG
ATELVTFVDNHDMPRFQSLGADGEALRLAVDLIMTCRGIPCLYYGTEQYLHDDTDGGNDP
YNRPMMDRWDTDTPLFQDIRVLSEVRRRNPAVKWGGQWTRYITPDVFAYVRKYRDSRCFV
AMNRSHEAVRLEAVLTELPDGAHRCVLSEAAFTIQDGRLEKLELAPRQVVVISFVGRPVR
GREIVRIQVNGFRTQPGEVVAVIGDCPELGDWDLSRAFRLEYINDNTWFGEIPFNKSANQ
IVAYKYVIFRENGPPINENRTSRRRFVPDKSIAKWRDVWEEG
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcgggtatgccctttctctatactcaagggggattaagggggatccgatggac
acgcaaaaaatcggcgaagtcgagccgcactcgcaaatcgaagtccaggagaaagaagac
gagtttgtcaatctgctgcagctgagcgatatcgaatttcggggtgagacgatttacttt
atcgtggtcgatcgcttcttcaacggcgaccccgacaacgacgacggaccggacccgagc
ctctatgaccccgagcgccaggactggggcaagtactgggggggcgacctgcagggcatt
atcgagaagctcgactatctgcaacagctcggagtgacggccgtctgggtgacgccgctc
ttcgagcaggtcgaggcgatggcctgggaggcggcccccatccatggctactggacacgc
gattttaagcgcatcaacccgcgctgggtggcgggggagcacgaggtgcgcctgttcgag
cgcaacgacacgaccttcgaccggctcatcgaagcactccacaagcgcggcatgaagctc
gtcctcgacatcgtctgcaaccacagctcccccgacgccgggggcatcaaaggtcaactt
tttgacgacggcaagctcatcgccgactacaacgacgacaaagaccactggtaccaccac
tacggcgaggtgaacaattgggacgacgagtggcaggtgcaaaactgcgacctggcgggg
ctggccaccttcaacgaaaacaacgtccgctaccgcaactacatcaaaggtgccatcaag
ctctggctggataagggcgtcgacgccctgcgggtcgatacggtcaagcacatgcccatc
tggttctggcaggaattcaactccgacatccaggctcacaaaccggacgtatttgtcttc
ggcgaatggatctattcgcacccgttgggcgagcgcccggtcgagtttgccaactattcg
gggatgacgattcttgattttgggctgtgcgtggccatccgcaaggccctcggccagggc
ggcgtgggcggctttcacctcatcgaggacgtcttcaaagaagactggcgctaccggggg
gctaccgaactggtcacttttgtcgacaaccacgacatgccgcgcttccagtcgctcggg
gcggacggtgaggcgttgcgtctggcggtggacttgatcatgacctgccggggaattcct
tgtctatactacggcaccgagcagtacctgcacgacgacaccgacggcggcaatgacccc
tacaatcggccgatgatggatcgctgggacaccgacacgccgctgtttcaagatattcgg
gtgctctcggaggtgcgacggcgcaacccggcggtcaagtggggcggtcagtggacgcgc
tatatcaccccggatgtctttgcttatgtgcgcaagtaccgcgactcgcgctgctttgtg
gcgatgaaccgcagccacgaagcggtgcggctcgaagcggtgctcaccgaactgcccgac
ggcgcgcatcgctgcgtgctgagcgaggccgcattcacgatccaagacggtcgcctcgaa
aaactggaactcgctccccggcaggtggtggtgatcagctttgtgggcaggcctgtgcgc
ggacgcgagatcgtccgcatccaggtcaacggttttcgcacccagccgggggaagtggtc
gcggtgatcggcgactgcccggaactgggcgactgggacttgagccgcgcctttcgcctg
gagtacatcaacgacaacacctggtttggagagattccttttaataagagcgccaaccag
atcgtcgcctacaagtacgtgatcttccgcgagaacggcccgcccatcaacgaaaaccgc
accagccgccgccgcttcgtgccggacaagagcatcgccaagtggcgcgacgtgtgggaa
gaaggctga

DBGET integrated database retrieval system