KEGG   Gloeobacter violaceus: glr0629Help
Entry
glr0629           CDS       T00148                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gvi  Gloeobacter violaceus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    glr0629
Enzymes [BR:gvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     glr0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
671339..673576
Genome map
AA seq 745 aa AA seqDB search
MGLAMQRSIEGLAGGERDEMLQGVVERVTFHNPQNGYTIARVAVRGLADLATVVGNFAQL
QPGQTMQFWGCWKDHPQYGPQFLAHRHEETRPATIGGLEKYLGSGLIKGVGPVTARRIVA
HFGLASLEIIESDCSRLAEVPGVGAHRIRLIQAAWQEQKAIKEVMLFLQSHQVNTTHAVK
IFKTYGDEAIERVRTNPYQLAQDIWGIGFRTADQIAQNLGVAPDSDERLKAGILYALITA
TEEGHCYLPLEEMLDQAVALLRLEEVAESVRPRLVEMARALVREGQIKAERPSGGAEAPV
VCFQPSLWQCEVGLARRLCERPPAPVDTGRVEAWLERYTHHHGLQLSAEQRQAVMLAARE
PVTVLTGGPGTGKTLTTRAVAALWKAMGKKVLLASPTGRAAQRLAEVSGQEAKTIHRLLE
FDPSTMGFKRCAENPLDAQAFVIDEASMIDVVLAYNLLKAIPAGAQVLLVGDQDQLPSVG
PGNVLADLVRSPAIPTARLTQVFRQAAASRIITNAHRINSGQMPDLAGEGSDCLFIEAHE
PAQVVERVREFVVQELPRRGFRSLADAQVLCPMNRGLVGSNHLNTVLQEALNPLPPDGGE
LDRGRRLFRVGDRVIQLRNNYDLGVFNGDLGTIAGIDFENQKLQVQFFERTMGYDFADLN
ELSLAYAISIHRSQGSEYPVAIIPVHTQHFPMLSRNLLYTGLTRARKLAVLVGTRKAIAI
AVREVKAMQRYTRLSERLSPLQADE
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgggactggcgatgcagcgatcgatcgaagggctggcaggcggggagcgcgacgagatg
ctccagggtgtcgtcgagcgcgtcacctttcacaacccccagaacggctacacgatcgcc
cgggtagcggtgcgcggactggcggatctggcgacggtggtgggcaattttgctcagctg
cagccgggccagacgatgcaattttggggttgctggaaagatcatccccagtacggtccc
cagtttctggcccatcgccacgaggagacccgccccgccaccattggcggcctcgaaaaa
tatctcggatcgggcctgatcaagggcgtggggccggtgaccgcccggcgcatcgttgct
cacttcggcctggcgtctctcgaaattatcgaaagcgactgcagccggctcgccgaggtg
ccgggggtgggtgcccaccgcatccggctcattcaggcggcctggcaggagcaaaaggcg
atcaaagaagtgatgctctttttgcagtcgcaccaggtgaacaccacccacgccgtcaaa
attttcaagacttacggcgacgaggcgatcgagcgggtgcgcaccaacccctaccagctg
gcccaggacatctggggcatcggctttcgcaccgccgatcagatcgctcagaaccttggg
gtggcccccgacagcgacgagcgtctcaaagccgggatcctctacgcgctcatcaccgcc
accgaggaggggcactgctacttgccgctggaggagatgctcgatcaggccgtggcactg
ctgcgcctggaggaagtggccgaatcggtccggccgcgcctggttgagatggcccgcgcg
ttggtgcgcgaagggcagatcaaagcggagcggccgtcaggcggggcggaggcgcccgtg
gtctgcttccagccgtcgctgtggcagtgcgaggtgggcctggcgcggcggctgtgcgag
cgcccccctgccccggtggacaccggccgcgtcgaggcgtggctcgaaagatacacccac
caccacggcctgcaactttctgccgagcagcgccaggcggttatgctggccgcccgcgaa
ccggtgaccgtccttaccggcgggccgggaacgggcaaaacgctcaccacccgggcggtc
gccgctctgtggaaggcgatgggcaaaaaggtcctgctcgcttctcccaccggccgggcc
gcccagcgcctggcggaggtgagcggccaggaagcgaaaaccattcatcggttgctcgaa
ttcgatccgagcacgatgggcttcaagcgctgtgccgaaaatcccctcgacgcccaagcg
tttgtgatcgacgaagcttcgatgatcgacgtggtgctcgcctacaacctgctcaaggcc
atccctgcgggggcgcaggtgctgctggtgggcgaccaggaccagttgcccagcgtcggc
cccggcaacgtgctggccgatctggtgcgctcaccggccatccccaccgcccggctcacc
caggtctttcgccaggccgccgcgagccgcatcatcaccaacgcccaccgcatcaactcg
ggccagatgccggatctggcgggcgaagggtccgactgcctgtttatcgaagcccacgag
cctgcgcaggtggtcgagcgcgttcgcgaattcgtcgtgcaagagttgccccggcgggga
tttcgctccctggccgatgcccaggtgctctgcccgatgaaccggggactggtgggctcc
aaccacctcaacaccgtcctgcaggaagccctcaaccccctgcctcccgacggcggcgag
ctcgatcgcggcaggcgactatttcgagtgggcgaccgggtgattcagctgcgcaacaat
tacgacctgggggtcttcaacggcgatctgggcacgatcgcggggattgactttgagaac
caaaagcttcaggtgcaatttttcgagcgcaccatgggctacgacttcgccgatttgaac
gaactgtcgcttgcctacgcgatcagcatccaccgcagccagggcagcgagtatccggtg
gcgattatcccggtgcacacccagcactttccgatgctcagccgcaacctgctctatacc
ggtctgacccgggcacgcaaactggcggtgctggtgggtacccgcaaggccattgccatc
gccgtgcgcgaagtgaaggccatgcagcgctacacgcggttgtccgaaaggctctcgcct
ttgcaggcagacgagtag

DBGET integrated database retrieval system