KEGG   Gloeobacter violaceus: glr1699Help
Entry
glr1699           CDS       T00148                                 

Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gvi  Gloeobacter violaceus
Brite
Enzymes [BR:gvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     glr1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 RrnaAD CMAS Methyltransf_18 MTS Methyltransf_32 Methyltransf_12 TPMT Methyltransf_24 ACP_syn_III_C AlaDh_PNT_C GCD14 Methyltr_RsmB-F
Motif
Other DBs
NCBI-GeneID: 2598479
NCBI-ProteinID: NP_924645
CYORF: glr1699
UniProt: Q7NJY2
Position
1808024..1808728
Genome map
AA seq 234 aa AA seqDB search
MFAPPFGPLEPPVGHLAQQADHRQFQRQRMVDEQLRPRGVEAQAVLAAMAKVPRHRFVPP
PYTRLAYEDRPLPIGHSQTISQPFIVAYMSEAARITPGAKVLEIGTGSGYQAAVLAEMGA
EVYTVEIVPELAKRAERTLEELGYRSVRVRSGDGYQGWPQHAPFDAIVVTAAPERIPQPL
IDQLAVNGRLIVPVGTQTEDQRMTVLTRTPGGIVEQKTFPVRFVPLTREKPQEH
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgctccccccttcggaccgcttgagcccccagtgggtcatctggcccaacaagcc
gaccaccgccagttccagagacaacggatggtcgacgaacagttgcggccccgcggcgtc
gaggcgcaggcggtgctcgcggcgatggcgaaggtgccgcgccaccgctttgtcccgccg
ccctatacccggcttgcctacgaggaccggccgctgcccatcgggcatagccagacgatt
tcccagccgtttattgtcgcctacatgagcgaggccgcccgcatcacaccgggtgcgaag
gtgctcgaaatcggcacaggctccggttaccaggctgccgtgctggccgaaatgggggca
gaggtttacaccgtcgagattgtaccggaactggccaagcgggcggagcgcaccctggag
gaactgggctaccgcagtgtgcgcgtgaggagcggggacggttatcaaggctggccgcag
cacgccccgttcgatgcgatcgtggtcaccgccgccccggagcgcatcccgcagccgctc
atcgatcagctcgcggtgaacggccggctgatcgttccggtgggcacccagacggaagac
cagcggatgacggtactgaccagaacgcccggcggcatcgtcgagcaaaaaacatttccg
gtgcgctttgtgcccctgacccgggagaagcctcaggaacattga

DBGET integrated database retrieval system