KEGG   Gloeobacter violaceus: glr1747Help
Entry
glr1747           CDS       T00148                                 

Definition
dihydrokaempferol 4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
gvi  Gloeobacter violaceus
Brite
Enzymes [BR:gvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     glr1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
1852612..1853625
Genome map
AA seq 337 aa AA seqDB search
MTLRVFVTGGTGFVGANLVRLLLTEGYSVRALVREPAKAQDLAALGAEVVAGDLGSRALA
GQMAGCRALFHVAAHYSLLQADRERLWQSNVLGTRNVLAAAREAGVERTVYTSSVAAIGV
KSPRADENHQSPPDKLVGVYKQSKYWAEQEARRAAARGQDVVIVNPTAPVGPFDSKPTPT
GDIVLRFLRRQMPFYLETGLNFVHVRDVVQGHLAALERGRSGERYILGHRDLSFKALLDT
LAEVTGIPAPQMAVPDWLPLGVAWIDEQLLSPLLGRPPSVPIDGVRMAAQPMYYDASKAV
RELGLPQTPVREALVDAVDWFRKNGYIGNGGGFRHGG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcgcgtgttcgtgacgggcggcaccggcttcgtgggagccaacctcgtgcgc
ttgctgctcaccgaaggttacagcgtgcgcgccctggtgcgtgaacctgcgaaggcacaa
gatctggcggccctcggtgccgaagtggtagccggagatctgggcagtcgcgctctggct
gggcagatggcgggctgccgggcgctctttcacgtcgccgcccactacagcttgctgcag
gccgatcgcgagcggctctggcaatcgaacgtgctcggaacccgcaacgtgctcgcggca
gcccgcgaggcaggggtagagcggacggtctacacctcatcggtggcggccatcggcgtc
aaaagcccccgcgccgatgaaaaccaccagagcccaccggacaaactcgtgggcgtctac
aaacagtcgaaatattgggcggagcaggaagcacgtcgggccgctgcccgcggccaggat
gtggtgatcgtcaacccgaccgcgccagtgggtcccttcgacagcaaaccgacgccgacc
ggcgacatcgtgttgcgcttcttgcgccgccagatgcccttttatctggagaccggcctc
aacttcgtccacgtgcgcgacgtggtccaggggcacctggctgccctggagcggggccgc
tcaggggagcgctacatcctcggacaccgagatttgtctttcaaagcgctgctcgacacg
ctggcggaggtgaccggcataccagccccacagatggctgttcccgattggctgcccctg
ggagtggcctggatcgacgagcagctgctctcgcccttgctcggccgcccccccagcgtg
cccatcgacggcgtgcgcatggccgcccagccgatgtactacgacgcctcgaaggccgtg
cgcgaactggggctgccccagacccccgtccgggaagcgctcgtcgatgccgtagactgg
tttagaaagaacggatacatcggcaacggggggggattccggcatggcggttag

DBGET integrated database retrieval system