KEGG   Gloeobacter violaceus: glr2647Help
Entry
glr2647           CDS       T00148                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gvi  Gloeobacter violaceus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    glr2647
Enzymes [BR:gvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     glr2647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
2802275..2803345
Genome map
AA seq 356 aa AA seqDB search
MQLAASAVLKKDSLEIYPGGKERATAMARAAIALGANLGERLETLTRAVRSLHRPGDGLA
VTAISSWYETEPVGPVQPLYINGCLTLQTELAPVSLLGELQQREAAAGRTREVHWGARTL
DLDLLWYDDWVQADTVLTLPHPRLEERPFVLVPLAQIAPDWRHPLTDKRVADLGAEVSAR
GVERVVERAVVATALGPVDLRPLAPADHPPLRDLAVRCWWATYRGLLEEEYIESFVGHTY
SLEAIGRAAARPDGHFWVAEAPGGALVGFTQVLAVGRVAHLVRLYVAPEVQALGIGSALW
RLVHSKLAAIGVGVCTLTVLATNVGAVRFYERQGFERTGSTPGNRFEYRIRIGGDG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcgctgcttcagcggtgctgaagaaagattctctcgaaatatatcctggtgga
aaagagagggcaacagccatggccagagcagcgatcgcgctgggcgccaatctcggggag
cgcctggagacgcttacccgggcggtgcgctcgctgcaccgtcctggggacggtctggcg
gtgacggcaatttccagctggtacgagacagaaccggtcggtccggtgcaaccgctttat
atcaacggctgcctaaccctccagaccgagctggccccggtgagcctgttgggcgagttg
cagcagcgcgaggcggcggccgggcggacgcgcgaggtgcactggggggcacgcacgcta
gatctcgatttgctgtggtacgacgactgggtgcaggcggataccgtcctgacgctgccc
catccgcgcctggaggagcgccccttcgtgctggtgccgctggcccagatcgctcccgac
tggcgccatccgctcacggacaagcgcgtcgccgatctgggcgccgaggtttcggcgcgg
ggcgtcgagcgcgtcgtggaacgggccgtggtggccactgccctcggcccggtggatctc
agaccccttgccccggcggatcacccgccgctcagggatctggcggtgcgctgctggtgg
gcgacctaccggggcctgctcgaagaggaatatatcgaatcgttcgtgggccacacctac
agcctcgaagcgattggccgggctgccgcccgcccggacggccatttttgggtggcggag
gcgccggggggcgccctggtgggttttacccaggtgctggcggtcgggcgggtcgcgcat
ctggtccgcctctacgtggctcccgaggtgcaggccctaggtatcggttccgccctgtgg
cgcctggtccacagcaagctcgccgcaatcggggtgggggtgtgcaccctgacggtgctt
gccaccaacgtcggcgccgtccgcttctacgagcgccaaggttttgagcgcaccggcagc
acccccggcaaccgcttcgagtaccgcatccggatcgggggcgatggctga

DBGET integrated database retrieval system