KEGG   Gloeobacter violaceus: glr3156Help
Entry
glr3156           CDS       T00148                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gvi  Gloeobacter violaceus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    glr3156
   01230 Biosynthesis of amino acids
    glr3156
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    glr3156
  Energy metabolism
   00680 Methane metabolism
    glr3156
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    glr3156
Enzymes [BR:gvi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     glr3156
Exosome [BR:gvi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   glr3156
  Exosomal proteins of melanoma cells
   glr3156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
3358906..3359484
Genome map
AA seq 192 aa AA seqDB search
MRHGQTVLSEKRQFCGRTDPDLSAGGAQNVRALASWLAGESLPVQVFTSPLLRARRTARL
LEAAWPSPVVEPRLRESDFGDWEGLDGDTLQASDPAGFAAWMADPVGFRPPGGESVGELC
ERVAEFFQEALERFADQTIAAVCHGGPIRAMVLAGLGLPLECFWHFNPPWASVSRLEVRG
PVRQLRYFGQRG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcacgggcaaaccgtgttgagcgaaaaaagacaattttgcgggcgcaccgatccc
gatctcagcgcggggggagcccaaaatgtccgtgctctagcgagctggctcgcgggcgaa
tcgcttcctgtacaagtatttaccagccccttgctgcgcgcccggcggacggcccgtctg
ctcgaagcggcctggccgtcgcccgtggtcgagccgcgcctgcgcgagagcgattttggc
gattgggaaggtctggatggcgacacattgcaggcgagcgaccccgccggttttgccgcc
tggatggccgatccggtgggatttcggccaccggggggcgaatcggtcggtgagctttgc
gagcgggtggccgagtttttccaggaggcgcttgaacgctttgcggaccagacgatcgcc
gcggtctgccacggagggccaattcgggccatggtgctggcgggactcggcttgccgctg
gagtgcttctggcacttcaacccgccctgggcttcggtgagccgcctggaagttcgcggt
ccggtgcggcagttgcgctacttcgggcagcgcggctaa

DBGET integrated database retrieval system