KEGG   Gloeobacter violaceus: glr4043Help
Entry
glr4043           CDS       T00148                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gvi  Gloeobacter violaceus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    glr4043
  Metabolism of other amino acids
   00480 Glutathione metabolism
    glr4043
Enzymes [BR:gvi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     glr4043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
4240809..4241291
Genome map
AA seq 160 aa AA seqDB search
MATVSDITVQTVDGQARSLGRYKGQVLLIVNVASYCGYTPQYAGLEKLYRRYKDAGLRVL
AFPCNDFGGQEPGSNAEIAEFCSRYDVSFELFDKVGARGYYKHPLYVRLSEAAEPAGEVS
WNFEKFLIAKSGEIVGRYRSGIGPEDPQLVADIERELAKS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtggctaccgtcagcgatatcaccgtccagacagtagatgggcaggcccgttcccttggc
agatacaaaggtcaggtgctgcttatcgtcaacgtcgcttcctactgtggctacacgccc
cagtacgcgggcctcgaaaagctctaccgccgctataaagatgccgggttgcgggtactg
gcctttccctgcaacgactttggagggcaggagccgggttccaacgccgagattgccgag
ttttgcagccgctacgatgtcagcttcgagctgttcgacaaggtgggtgcgcgcggctac
tacaagcatcccctttacgtccgcctgagtgaagcggctgagcctgcgggggaagtgtcc
tggaattttgaaaagtttttaatcgctaaatcgggggagatcgtgggccgctaccgcagc
ggtatcggcccggaagatccgcaactggtcgccgatatcgaacgcgaactggcgaaaagt
tag

DBGET integrated database retrieval system