KEGG   Gloeobacter violaceus: gvip056Help
Entry
gvip056           CDS       T00148                                 

Gene name
gap1
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
gvi  Gloeobacter violaceus
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    gvip056 (gap1)
   01230 Biosynthesis of amino acids
    gvip056 (gap1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gvip056 (gap1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    gvip056 (gap1)
Enzymes [BR:gvi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     gvip056 (gap1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
567754..568770
Genome map
AA seq 338 aa AA seqDB search
MTIKVAINGFGRIGRNFLRCWLGRKQSDFEVVAINDTSDPNTNAHLLKYDSMLGQFSGEV
SADENSLTANGHTIKCFSDRNPLNLPWKDWGVDLVIESTGVFTSRDGASKHLAAGAKKVL
ITAPGKNDDGTFVMGVNDHNYDPEKHTIISNASCTTNCLAPVAKVLHENFKIVKGTMTTI
HSYTGDQRLLDASHRDWRRARAAALSIVPTSTGAAKAIGLVLPELKGKLDGLAFRVPTPN
VSVVDLVVEVEKPTLVEQVNHVLKEASENELKGILAFSEIPLVSIDYRITDVSSIVDAQL
TMVLKDNLVKVISWYDNEWGYSQRVVDLAELVARKWAA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacgattaaagtagcaatcaacggcttcgggaggatcgggcgcaacttcttgcgctgc
tggttgggtcgcaaacagtcggattttgaagtcgttgccatcaacgacacctccgacccc
aacaccaatgcacacctgcttaagtacgattcgatgctgggccagttcagcggcgaggtg
agcgccgacgaaaattcgctcaccgccaacggtcacaccatcaagtgcttttccgaccgc
aatccgctcaatctaccctggaaggattggggtgtcgatctggtgatcgaatcgacgggt
gtattcaccagccgcgacggtgcctccaagcaccttgccgccggcgccaaaaaagtgctc
atcaccgcgccgggcaagaatgacgacggcaccttcgtcatgggtgtcaacgatcacaac
tacgaccctgagaagcacacgattatctccaatgcttcttgcaccaccaactgcctggcc
ccggtggccaaggtgctccacgagaacttcaagatcgtcaagggcacgatgaccaccatc
cacagctacaccggcgaccagcgcctgctcgatgcgagccaccgcgactggcgccgcgcc
cgcgctgctgccctcagcatcgtgcccaccagcaccggggcggccaaggccatcggcctg
gtgctgcccgaactgaagggcaagctggatggtctggccttccgggtgcccacccccaac
gtctcggtggtggacctggtggtcgaagtcgaaaaacccacccttgtcgagcaggtcaac
cacgtcctcaaagaggcctccgagaacgaactcaaaggcatcctcgcctttagcgaaatt
ccgctagtgtcgatcgactaccggattaccgacgtctcgtcgatcgtggacgcccagctc
accatggtgctcaaggacaacctggtaaaggtgatctcctggtacgacaacgagtggggc
tactcccagcgcgtcgtcgatttggccgaactggtcgcccgcaagtgggcagcttaa

DBGET integrated database retrieval system