KEGG   Gloeobacter violaceus: gvip056Help
Entry
gvip056           CDS       T00148                                 

Gene name
gap1
Definition
glyceraldehyde-3-phosphate dehydrogenase
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
gvi  Gloeobacter violaceus
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Class
Metabolism; Overview; Carbon metabolism [PATH:gvi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gvi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gvi00010]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:gvi00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
567754..568770
Genome map
AA seq 338 aa AA seqDB search
MTIKVAINGFGRIGRNFLRCWLGRKQSDFEVVAINDTSDPNTNAHLLKYDSMLGQFSGEV
SADENSLTANGHTIKCFSDRNPLNLPWKDWGVDLVIESTGVFTSRDGASKHLAAGAKKVL
ITAPGKNDDGTFVMGVNDHNYDPEKHTIISNASCTTNCLAPVAKVLHENFKIVKGTMTTI
HSYTGDQRLLDASHRDWRRARAAALSIVPTSTGAAKAIGLVLPELKGKLDGLAFRVPTPN
VSVVDLVVEVEKPTLVEQVNHVLKEASENELKGILAFSEIPLVSIDYRITDVSSIVDAQL
TMVLKDNLVKVISWYDNEWGYSQRVVDLAELVARKWAA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacgattaaagtagcaatcaacggcttcgggaggatcgggcgcaacttcttgcgctgc
tggttgggtcgcaaacagtcggattttgaagtcgttgccatcaacgacacctccgacccc
aacaccaatgcacacctgcttaagtacgattcgatgctgggccagttcagcggcgaggtg
agcgccgacgaaaattcgctcaccgccaacggtcacaccatcaagtgcttttccgaccgc
aatccgctcaatctaccctggaaggattggggtgtcgatctggtgatcgaatcgacgggt
gtattcaccagccgcgacggtgcctccaagcaccttgccgccggcgccaaaaaagtgctc
atcaccgcgccgggcaagaatgacgacggcaccttcgtcatgggtgtcaacgatcacaac
tacgaccctgagaagcacacgattatctccaatgcttcttgcaccaccaactgcctggcc
ccggtggccaaggtgctccacgagaacttcaagatcgtcaagggcacgatgaccaccatc
cacagctacaccggcgaccagcgcctgctcgatgcgagccaccgcgactggcgccgcgcc
cgcgctgctgccctcagcatcgtgcccaccagcaccggggcggccaaggccatcggcctg
gtgctgcccgaactgaagggcaagctggatggtctggccttccgggtgcccacccccaac
gtctcggtggtggacctggtggtcgaagtcgaaaaacccacccttgtcgagcaggtcaac
cacgtcctcaaagaggcctccgagaacgaactcaaaggcatcctcgcctttagcgaaatt
ccgctagtgtcgatcgactaccggattaccgacgtctcgtcgatcgtggacgcccagctc
accatggtgctcaaggacaacctggtaaaggtgatctcctggtacgacaacgagtggggc
tactcccagcgcgtcgtcgatttggccgaactggtcgcccgcaagtgggcagcttaa

DBGET integrated database retrieval system