KEGG   Gloeobacter violaceus: gvip058Help
Entry
gvip058           CDS       T00148                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gvi  Gloeobacter violaceus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gvi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
575748..576554
Genome map
AA seq 268 aa AA seqDB search
MTQIVGIVNITTDSFSDGGQFLDAERAIGHARRLRGEGAHWIDLGAESSNPDGEQVTAEI
EAERLAPVVAALSADGVSVAVDTCKSSVMVRCLELGARMINDITALADPRSVEVLKTFRV
PVVLMFARNRQARAEQRPGDCETVWNEIEAFFSGRIDRLLGAGLQERQLILDPGMGFFLG
SNPEPSLRVLAHVDRLGRFGLPVYLSVSRKSFIGSVLGGRPAGGRDHGTLAAEIWAYLAG
VDYLRTHAVAPLSDAIRVIAAIRAQALA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacccagatagtcggcatcgtcaacattactaccgattccttttcggacggaggccag
tttctcgatgctgagcgggccatcggtcatgcacggcggctgcgcggtgagggcgcccac
tggatcgacctgggtgcagaatcgagcaaccctgacggtgaacaggttacagcagaaata
gaagcagagcgcctcgccccggtcgttgccgcactgagcgcggacggggtctccgtggcg
gtcgacacttgcaaaagctcggtgatggttcgttgtctggaactgggcgctcggatgatc
aacgacatcaccgcccttgcagatccgcgcagtgtcgaagtgctcaaaacttttcgggtg
ccggtggtgctgatgtttgcgcgcaaccggcaggcccgcgccgagcagcggcccggggat
tgcgaaacggtctggaatgaaatcgaagcgtttttttcggggcggatcgaccggttgctg
ggtgccggtctgcaggagcgacagttgatacttgaccccggcatgggtttttttttgggc
agcaaccccgaaccgagtctgagggtgcttgcccacgttgaccgactgggccgcttcggc
ttgccggtgtacttgagtgtttcgcgcaagtcgtttatcggcagcgtactgggggggcgc
cctgccggggggcgagaccacggtaccctggccgccgaaatctgggcgtatctggccggt
gtggattacctgcgcacccacgcagtcgctccgctcagcgacgctatccgagtgattgca
gcaattcgggcgcaagcgctggcctga

DBGET integrated database retrieval system