KEGG   Gloeobacter violaceus: gvip115Help
Entry
gvip115           CDS       T00148                                 

Gene name
chlD
Definition
(RefSeq) Mg chelatase subunit
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00860  Porphyrin and chlorophyll metabolism
gvi01100  Metabolic pathways
gvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    gvip115 (chlD)
Enzymes [BR:gvi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     gvip115 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA Sigma54_activat AAA_5 MCM CCDC53 Mito_fiss_reg CAP_N PAXIP1_C
Motif
Other DBs
NCBI-GeneID: 2599296
NCBI-ProteinID: NP_923816
UniProt: Q7NM96
Position
916653..918662
Genome map
AA seq 669 aa AA seqDB search
MTASVPLAFPITAVVAQEAIKLALLLAVTDPGLGGVAISGRRGTAKSVMARGIHALLPPI
EVIAGCPANDDPDWPESWCDQCRRLYAQQTPQRAMRPVPFVQVPLGATEDRVIGTVDLEK
SMRLGEPVFQPGLLAEANRGILYIDEINLLDNQIANLLLTTLSEGINRVEREGLSFEHAC
AMVLLATFNPEEGELREHLLDRIAICLPAEAQLSLEERLEVVDQARGYARDPAAFVAAHR
GEIEELQTQIVLARQRLAEVSIEAEQIAYLVEEAVRGEVEGHRAELFALRAAKVHCALDG
RTRVNAEDLRRAVELVIIPRSTVIPSEEPPPPPPPPPPPPTDEQEQDEDEQQDDDPEEND
TDEQEEQEAPPSLPEDFVFDAEGVILDPRLLAFAQTVRRKSKSGARTKIYSDSRGRYVKP
ILPRGRVNRIAVDATLRAAAPHQKARREREPGRRVIVEAGDVRAKRLARKAGALITFVVD
ASGSMALNRMRSAKGAVLKLLTEAYQNRDKVALVPFRGEKADVLLPPTRSIAQARRRLES
LPCGGGSPLAHALSQAIRLGVNAQSAGDVGQVIIVAITDGRGNIPLARSLGEPPGDDKPD
IKGELLALAGRIRTLGFKLLVIDTENRFVSTGFAKELTTQAGGRYFYLPRASEQTLARAT
QDAIAELRD
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgactgcctctgtgccccttgcctttccgatcaccgccgtcgtcgcccaggaggcgatc
aagctcgccctgctgctcgcggtcaccgatccggggctggggggggtggccatcagcggt
cggcgcggcacggccaaatcggtgatggcccggggcatccacgccctgctgccgcccatc
gaagtgatcgccggttgcccagcaaacgacgatcccgactggcccgaatcctggtgtgac
cagtgccgccgcctctatgcccagcagactccccaacgggcgatgcggccggtgcctttt
gtgcaggtgccgctcggggctaccgaggaccgggtgatcggcaccgtcgatctcgaaaaa
tcgatgcgcctgggcgaaccggtctttcagccggggctgctcgccgaggcgaaccggggt
atcctctacatcgatgagatcaacctgctcgacaaccagatcgccaatttattgctgaca
accctcagcgaaggcatcaaccgcgtcgagcgtgagggcctcagctttgagcatgcctgc
gcgatggtgttgctcgccacgttcaaccctgaagagggcgaactgcgcgaacacctgctc
gaccgcatcgccatctgcctgcccgccgaggcgcagttgagcctggaggagcgtctcgaa
gtggtggaccaggcgcgcgggtacgcccgcgatccggcggcgtttgtggccgctcaccgc
ggcgagatcgaagaattgcagacgcagattgtgcttgcccgccagcgtctcgcggaagtg
agcatcgaagctgagcagattgcctacctggtcgaagaagccgtgcgcggcgaggtagag
ggccaccgggcggaactgtttgccctccgggcggcgaaggtgcattgcgccctcgatggg
cgcacccgcgtcaacgccgaggacttgcgccgggcggtcgagctggtgattattccgcgc
tcgacggtgatcccctcggaggagcccccaccgccgccacccccaccgccaccgcctccc
accgacgagcaggagcaggacgaggacgagcagcaggacgacgaccccgaggaaaacgac
actgacgagcaggaggagcaggaagcgcccccgagcctacccgaggattttgtcttcgac
gccgagggggtcattctcgatccgaggctattggcctttgcccagacggtgcggcgcaag
agcaaatccggggcgcgcaccaagatttattccgactcgcgcggccgttacgtcaagccg
atcctgccccggggccgggtgaaccgcatcgctgtagatgccaccctgcgcgccgccgcc
ccgcaccagaaagcccgccgcgagcgcgaaccgggtagacgggtgattgtcgaagcgggc
gatgtgcgcgccaagcgcctggcgcgcaaggccggggcgctcatcacctttgtggtcgac
gccagcggctcgatggccctcaaccggatgcgctcagccaaaggtgccgtgttgaaactg
ctcaccgaggcctatcaaaaccgcgacaaggtggcactcgttccctttcgcggcgaaaaa
gcggacgtgctgctgccgcccacccgctcgatcgcccaggcccgcaggcgcctggaatca
ttgccttgcggtggcggttcgcccttggcccacgccctcagccaggcgatccgcctgggg
gtgaacgcccagagcgcgggcgatgtcggccaggtgattatcgtggcgattaccgacggc
cggggcaacatacccctcgcccgctcgctgggcgaaccgccgggggacgacaaacccgac
atcaagggtgaactgctcgccctcgcgggccgcatccgtaccctgggtttcaagttgctg
gtcatcgacaccgagaaccgcttcgtctccaccggttttgccaaagaactgaccacccag
gcgggcgggcgctacttttatctgccccgcgccagcgagcagaccctggcgcgggccacc
caggacgcgattgccgaactgcgcgactga

DBGET integrated database retrieval system