KEGG   Gloeobacter violaceus: gvip142Help
Entry
gvip142           CDS       T00148                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00010  Glycolysis / Gluconeogenesis
gvi00051  Fructose and mannose metabolism
gvi00562  Inositol phosphate metabolism
gvi00710  Carbon fixation in photosynthetic organisms
gvi01100  Metabolic pathways
gvi01110  Biosynthesis of secondary metabolites
gvi01120  Microbial metabolism in diverse environments
gvi01130  Biosynthesis of antibiotics
gvi01200  Carbon metabolism
gvi01230  Biosynthesis of amino acids
Module
gvi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gvip142 (tpiA)
   00051 Fructose and mannose metabolism
    gvip142 (tpiA)
   00562 Inositol phosphate metabolism
    gvip142 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    gvip142 (tpiA)
Enzymes [BR:gvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     gvip142 (tpiA)
Exosome [BR:gvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   gvip142 (tpiA)
  Exosomal proteins of bladder cancer cells
   gvip142 (tpiA)
  Exosomal proteins of melanoma cells
   gvip142 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 2599076
NCBI-ProteinID: NP_923986
UniProt: Q7NLT1
Position
complement(1114986..1115708)
Genome map
AA seq 240 aa AA seqDB search
MRRKVLAGNWKMYKTRGEARAFLEAFVPLISPGAENREVILCGPFTCLDLLSAQAGPYAV
GAQNVHWADHGAYTGEIAPQMLVELGVHYVIVGHSERREYFNETDSTVNRRLNNAQDHDL
VPILCVGETESVRKDGITEAHIRSQLDRDLELVDMRRLIIAYEPIWAIGTGKTCEANEAN
RVCAMIRKHVNFEGVPILYGGSVKPENIDELMAQSDIDGVLVGGASLEAKSFARIVNFEV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
ttgcgacgaaaggttctggcgggcaactggaaaatgtataagacccgcggcgaagcgcgc
gccttcctggaggcttttgtaccgctcatctccccgggcgccgagaaccgggaggtcatt
ctctgcgggccgtttacctgcctcgacctattgagcgcccaggccggaccctatgccgtc
ggcgcacagaacgtgcactgggccgatcacggcgcctacaccggcgaaatcgctccccag
atgctcgtcgaactgggtgtgcactacgtgattgtcggccattctgagcggcgcgaatac
ttcaacgagaccgacagcaccgtcaaccgacgcctcaacaacgcccaggatcacgacctc
gtcccgattctctgcgtgggtgagaccgagagcgtgcgcaaggacggcatcaccgaagcc
cacatccgctcccagctcgatcgcgacctcgaactggtggacatgcgccgcctgatcatt
gcctacgaacccatctgggccatcggcaccggcaaaacctgcgaggcgaacgaagcgaac
cgggtgtgcgccatgatccgcaaacacgtcaacttcgaaggggtgcccatcctctacggc
ggctcggtcaaacccgaaaatatcgacgagttgatggcccagagcgacatcgacggcgtg
ctggtgggcggcgccagcctcgaagcgaagagcttcgcgcggatcgtcaacttcgaagtg
tga

DBGET integrated database retrieval system