KEGG   Gloeobacter violaceus: gvip142Help
Entry
gvip142           CDS       T00148                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gvi  Gloeobacter violaceus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    gvip142 (tpiA)
   01230 Biosynthesis of amino acids
    gvip142 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gvip142 (tpiA)
   00051 Fructose and mannose metabolism
    gvip142 (tpiA)
   00562 Inositol phosphate metabolism
    gvip142 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    gvip142 (tpiA)
Enzymes [BR:gvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     gvip142 (tpiA)
Exosome [BR:gvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   gvip142 (tpiA)
  Exosomal proteins of bladder cancer cells
   gvip142 (tpiA)
  Exosomal proteins of melanoma cells
   gvip142 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1114986..1115708)
Genome map
AA seq 240 aa AA seqDB search
MRRKVLAGNWKMYKTRGEARAFLEAFVPLISPGAENREVILCGPFTCLDLLSAQAGPYAV
GAQNVHWADHGAYTGEIAPQMLVELGVHYVIVGHSERREYFNETDSTVNRRLNNAQDHDL
VPILCVGETESVRKDGITEAHIRSQLDRDLELVDMRRLIIAYEPIWAIGTGKTCEANEAN
RVCAMIRKHVNFEGVPILYGGSVKPENIDELMAQSDIDGVLVGGASLEAKSFARIVNFEV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
ttgcgacgaaaggttctggcgggcaactggaaaatgtataagacccgcggcgaagcgcgc
gccttcctggaggcttttgtaccgctcatctccccgggcgccgagaaccgggaggtcatt
ctctgcgggccgtttacctgcctcgacctattgagcgcccaggccggaccctatgccgtc
ggcgcacagaacgtgcactgggccgatcacggcgcctacaccggcgaaatcgctccccag
atgctcgtcgaactgggtgtgcactacgtgattgtcggccattctgagcggcgcgaatac
ttcaacgagaccgacagcaccgtcaaccgacgcctcaacaacgcccaggatcacgacctc
gtcccgattctctgcgtgggtgagaccgagagcgtgcgcaaggacggcatcaccgaagcc
cacatccgctcccagctcgatcgcgacctcgaactggtggacatgcgccgcctgatcatt
gcctacgaacccatctgggccatcggcaccggcaaaacctgcgaggcgaacgaagcgaac
cgggtgtgcgccatgatccgcaaacacgtcaacttcgaaggggtgcccatcctctacggc
ggctcggtcaaacccgaaaatatcgacgagttgatggcccagagcgacatcgacggcgtg
ctggtgggcggcgccagcctcgaagcgaagagcttcgcgcggatcgtcaacttcgaagtg
tga

DBGET integrated database retrieval system