KEGG   Gloeobacter violaceus: gvip169Help
Entry
gvip169           CDS       T00148                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase/methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
gvi  Gloeobacter violaceus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    gvip169 (hemD)
Enzymes [BR:gvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     gvip169 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     gvip169 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1310706..1312232
Genome map
AA seq 508 aa AA seqDB search
MPGTVYLVGAGPAGAEYLTVRGRELLEQAEVVLYDDLADPHLLKLASAAQLIDVGKRAGR
PGADQGEIGRLLVTHCQAGRRVVRLKAGDPLVFGRAAAELGALVAAGCNFEIVPGVSSAL
AACAFAGIPLTDRALGRHFCVMSGHDIGTLPWQHLAHIDTLVILMGTRHLEAIAEQLMDY
GRPAAMPVAVIFWAGRSEQRTVVGTLEDIASRVAPSGEPAVIVVGPVVRRRECFDWFDRR
ALFGKHILVTRAADQAGGFSAQLEALGASVLEMPALVVTAPTSWEPLDRAIAQLAGYRWL
LLTSANGVEAFFARLTHHRRDLRALGGVRVAAVGPKTAQAARTHGLICDFVPGQYVSDGL
LTDFPDIAGIYGERVLFVRVESGGRETITEQFRRWGALVDEVAGYATGCPDSAEPGCVAA
LRAGRIDCATFASAKTVRHFARLLQGEELESLLRKVRIASIGPQTSAACRETLGRVDVEA
EVFTLDGLAQAIVADLGTGRATGPTDEQ
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgccgggtacggtctatctggtgggggcgggaccggccggggccgagtatttgaccgtc
cgcggccgggagctgttggagcaggccgaggtcgttctctacgacgatctggcagacccg
cacttgctgaaactcgctagtgcggcccaactcatcgatgtcggcaagcgggccggccgg
ccgggagccgaccagggcgagatcggccgcctgctggtaacccactgtcaggcgggccgt
agggtggtgcggctaaaggcgggcgacccgcttgtctttggccgcgctgcggcggaacta
ggagcgctggtggcggccgggtgcaactttgagatcgtgccgggggtgagttccgccctt
gccgcctgcgcgtttgccggcatcccgctcaccgaccgtgccctcggccgccacttttgc
gtgatgagtggccacgatatcggcaccctaccctggcagcatctggcccacatcgacacg
ctcgtcatcttgatgggcacccgccacctcgaggcgatcgccgagcagctgatggactac
ggccgtccggcggcgatgccggtggcggtgatcttctgggcagggcggtccgagcagcgc
acggtggtgggtaccctcgaagacatcgcaagccgggttgcgccctccggcgagccggcg
gtgatcgtcgtgggaccggtggtccgccgccgcgagtgcttcgactggtttgaccgccga
gcgctgtttggaaaacacatcctcgtcacccgcgcggccgatcaagccgggggattcagt
gcccaactggaggcactgggtgcctcggtcctggagatgcccgccctggtagtcactgcg
cccaccagctgggaaccgctcgatcgggccattgcccagctggccggctaccgctggctg
ttgctgacctccgccaacggcgtggaggcgttctttgcgcgtctgacccaccacagacgc
gacctgcgcgccctgggcggggtgcgcgtcgccgccgtcggacccaagactgcccaggcc
gcccgcacccatggactgatctgcgacttcgtaccgggtcagtacgtctccgacggactg
cttaccgattttccggacatcgccgggatctatggggagcgggtgctctttgtgcgggtc
gaatccggaggccgcgagacgatcaccgagcagtttcgccgctggggcgctcttgtcgat
gaggtcgcaggctacgctaccggctgcccggatagcgccgagccgggctgcgtcgccgct
ctacgcgcaggccggatcgactgtgccaccttcgccagcgccaaaaccgtgcgccatttt
gcccgcctcctccaaggcgaggagctggaatcgcttctgagaaaagtgcgtattgcttcg
atcgggccgcagaccagtgctgcctgccgcgagacactggggcgggtggacgtcgaggcc
gaagtctttaccctcgatggactcgcccaggcgattgtcgccgatctcggcaccggcagg
gcgaccgggccgacagacgaacaatga

DBGET integrated database retrieval system