KEGG   Gloeobacter violaceus: gvip170Help
Entry
gvip170           CDS       T00148                                 

Gene name
desC
Definition
delta-9 acyl-lipid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
gvi  Gloeobacter violaceus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gvi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:gvi01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1312274..1313095
Genome map
AA seq 273 aa AA seqDB search
MTAQSPATQATPISWVFVGFMAFIHLGALAALWQFSWSALALAIFLHWALGCLGITLGFH
RLLSHRSFTVPKPLEYFLALLGTLCLQGGPVLWVAHHRLHHAHSDTEADPHDSNRGFWWS
HWGWMFYMPEERLNFDHYSRYAKDLARDPVHRFLNRNMIPLQLAFAALLYLLGGWPFVLW
GIFVRLVVVFHCTWLINSACHQWGYRSHQTDDHSTNLWWAAILAYGEGWHNNHHAMPRSA
RHGLAWWEIDVTWSVIWILSKLGLARNVQLPTS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagagccctgccacccaggccacgcctatctcctgggtcttcgtcggtttt
atggcctttattcaccttggtgccctggcggcgctgtggcagttttcgtggtcggccctg
gcgctggccatttttttgcactgggcgctcggctgcctggggatcaccctcggttttcac
cgtctgctcagccaccgcagcttcacggtgcccaagccgcttgaatatttcctggccttg
ctcggcactctatgcctgcaaggtggtcccgtcctctgggtggcgcaccaccgcctgcac
cacgcccactccgacaccgaggccgacccgcacgattcgaaccgaggtttttggtggagc
cactggggctggatgttctacatgcccgaggagcggctcaacttcgatcactactcgcgc
tacgccaaggatctggcccgcgacccggtgcaccggtttctcaaccgcaatatgatccct
ctccagttggcctttgcagcgcttttgtacctgttgggcggctggccgttcgtgctgtgg
ggcatcttcgtgcggctggtggtcgtattccactgcacctggctgatcaattccgcctgc
caccagtggggctaccgcagccaccagaccgacgaccactccaccaacctctggtgggcg
gcgatcctggcctacggtgaaggctggcacaacaaccaccacgccatgccgcgctctgcc
cgccacggccttgcctggtgggagatcgacgtcacctggagtgtgatctggatactcagc
aagctcggcctggcccgcaacgtccaattgccgacctcttag

DBGET integrated database retrieval system