KEGG   Gloeobacter violaceus: gvip192Help
Entry
gvip192           CDS       T00148                                 

Gene name
glgB
Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gvi  Gloeobacter violaceus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    gvip192 (glgB)
Enzymes [BR:gvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     gvip192 (glgB)
Exosome [BR:gvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   gvip192 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1397516..1399717
Genome map
AA seq 733 aa AA seqDB search
MNPTVELRDIEALVTNLHADPFAILGPHRAEDGGAWVVRTYQPGASRVVLLGESGELAME
NRRHPDLFECAVPTAPGAYRLRVEDAWGERLIEDAYRFRGSLLSDLDGHLFAEGNHHRIY
EKLGAHPAVFEGVAGVYFAVWAPSARNVSVLGDFNRWDGRFHQMRRVERSTGIWELFIPE
LGEGTVYKFEIKNGFGHIYEKSDPYAFQQELRPKSGSVVADLDRYSWNDGEWLKRRALSN
PLKQPLAIYEVHLGSWMRVPEEGDRFLSYTELADKLIPYVKDLGFTHIELLPILEHPFDG
SWGYQVLGYYAPTSRFGNPTEFMAFVDRCHQSGIGVILDWVPAHFPKDGHGLALFDGTHL
YEHADSRQGEHKEWGTLVFNYGRNEVRNFLIANALFWFERYHIDGIRVDAVAAMLYLDYS
RHDGEWVANRYGGRENLEAIGFLRQLNELIFLYYPGALSIAEESTAWPLVTRPPYLGGLG
FNLKWHMGWMHDTLAYFRTDPLFRRYRHNDITFSITYTFYENFVLALSHDEVVHMKGSII
GKMPGDGWQKFANLRALFTFMYGHPGKKTLFMGMEFAHGREWNAYQSLDWHLLDYPQHRQ
MQQFVRALNRLYTGQPALYEEDCNPAGFFWVDCHDVLNSVFTFVRRGKDPSEQLLFVCNF
TPTYHPHYRVGVLETGFWQEIFNSDSGIYGGSNKGNLGGLWSENWAIHGQPYSLGLQLPP
LGCLVFKRRKEQD
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaactgtggagctgcgggatatcgaagcgctggtgaccaatttgcacgccgat
ccctttgccattctcggtccgcaccgagcagaggacggtggggcctgggtggtgcggact
taccagccgggtgcttcccgggtggttctgctcggcgaatccggcgagcttgctatggag
aatcgtcggcacccggatctgttcgagtgcgccgtgcccacggctccaggggcctaccgg
ctgcgggtggaagacgcttggggcgagcgtttgatcgaggacgcctatcggtttcgcggc
tcgctcttgagcgatctcgacggccacctgtttgccgagggcaaccatcaccgcatctac
gagaaattgggtgcccacccggccgtcttcgagggggtggcgggggtctattttgcggtg
tgggcgcccagtgcccgcaatgtgagtgtgctgggcgacttcaatcgctgggacggccgc
ttccaccagatgcgcagagtcgagcgttccaccggcatctgggagctattcatacctgaa
ctgggcgaggggacggtctacaaattcgagatcaaaaacggcttcggccatatttatgaa
aagtccgacccctacgctttccagcaggaattgcgccccaagagcggttcggtggtagcc
gatctcgaccgctacagctggaacgacggtgaatggctcaagcggcgcgcactctccaac
ccgctcaagcagccacttgccatttacgaggtgcacctgggctcctggatgcgggtgccc
gaggaaggcgaccgcttcttgagctacacagaactggcggacaagcttattccttacgtc
aaggatctgggctttacccacatcgaactgctgccgatcctggagcaccccttcgacggc
agttggggctatcaggtgctgggctactacgcccccacttcgcgcttcggaaacccgacg
gagttcatggcctttgtcgatcgctgccaccagtcagggatcggcgtcatcctcgactgg
gtaccggcccactttcctaaagacggccacggcctcgcccttttcgacggcacccatctg
tatgagcacgccgactcgcgccagggcgaacacaaagagtggggcaccctcgtgttcaac
tacgggcgcaacgaggtgcgcaacttcttgattgccaacgccctattttggttcgagcgc
taccacatcgacggcatccgggtggacgcggtagcggcgatgctctatctcgattactcg
cgccacgacggcgagtgggtggccaaccgctacggcgggcgcgagaacctcgaagcgatc
ggttttttgcgccagctcaatgaactgatttttctttactatcccggggcactctcgatc
gccgaggagtccaccgcctggcccctggtcacgcgacccccctatctcgggggcctgggc
ttcaacctcaagtggcacatgggctggatgcacgataccctcgcctacttccggaccgat
ccgctctttcgccgctaccggcacaacgacatcaccttctcgattacttacacgttctac
gagaactttgtgctggccctttcccacgacgaagtcgtgcacatgaaaggctcgatcatc
ggcaagatgccgggggacggctggcaaaaattcgccaatttgcgggcgctcttcactttt
atgtacgggcatccgggcaagaagacgctgtttatgggcatggaatttgcccacggccgc
gagtggaacgcctaccaatcgctcgactggcacctgctcgactacccgcagcaccggcag
atgcagcagttcgtgcgcgctctcaaccggctttacaccggccagcccgccctgtacgaa
gaagattgcaacccggcgggctttttctgggtcgactgccacgacgtgctcaacagcgtc
ttcaccttcgtgcgccgcggcaaagacccgagcgaacaactgctgttcgtctgcaacttt
accccgacctatcaccctcactaccgggtgggtgtactggagacgggtttctggcaggaa
attttcaacagcgactcgggtatctacgggggcagcaacaaaggcaacctcggcggcctg
tggagcgagaactgggccatccacggccagccttattcgctgggtctgcaactgcctcct
ctgggctgcctggtcttcaagcggcgcaaggaacaggactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system