KEGG   Gloeobacter violaceus: gvip235Help
Entry
gvip235           CDS       T00148                                 

Gene name
chlI
Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
gvi  Gloeobacter violaceus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    gvip235 (chlI)
Enzymes [BR:gvi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     gvip235 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1823793..1824869
Genome map
AA seq 358 aa AA seqDB search
MVSQTSGRRPVFPFTAIVGQEEMKLALILNVIDPKLGGVMIMGDRGTGKSTTVRALAELL
PEIEVVTGDPYHSDPYNQDLMSDEVRGRKLAGEALPVERRQVQMVDLPLGATEDRVCGTI
DIEKALSEGVKAFEPGLLARANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVEREGISV
RHPARFVLVGSGNPEEGELRPQLLDRFAMHAEVRTVKDPKSRVQIVQQRGEFDGNPQRFL
AAHRKAQQELTRRIAKAQQLLKKTEVSDDLQLKIAQVCSELDVDGLRGDIVTDRAARALA
AFEGRGRVTVEDIQRVIVLCLRHRLRKDPLESIDSGYKVEKVFRRIFDLPPPETNAAQ
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtggtttcccagacgagcggccggcggccggtctttccttttaccgccatcgtcggccag
gaggagatgaaactggccctcatcctcaacgtcatcgaccccaagctcggaggggtaatg
atcatgggcgatcggggaaccggcaaatcgacgaccgtgcgcgccctggccgaactgctt
ccggagatcgaagtagtaacgggagatccctaccacagcgacccctacaaccaggatctg
atgagcgacgaggtgcgcgggcgcaaactggcaggtgaagcgttgcccgtcgagcgccgc
caggtgcagatggtggatctgcccctcggggccaccgaagaccgcgtctgcggcacgatc
gacatcgaaaaagccctctccgagggcgtcaaagccttcgagccggggctgctcgcccgt
gccaaccggggcattctctacgtcgacgaggtcaacctgctcgacgaccacctggtggat
gtactgctcgattcggccgcttccggctggaacacggtcgagcgcgagggcatctcggtg
cgccacccggcccgcttcgtgctggtcggttcgggcaaccctgaagaaggcgaactcagg
ccccagttgctcgaccgcttcgccatgcacgccgaggtgcgcacggtcaaagatccgaaa
tcgcgggtgcagattgtccagcaacgtggcgaatttgacggcaacccccaacgctttctt
gccgctcaccgcaaggcgcagcaggaactgacgcggcgcatcgccaaggcccagcagttg
ctcaaaaaaaccgaagtctccgacgatttgcaactgaagatcgcgcaggtctgctccgaa
ctggatgtggacgggttgcgcggcgacatcgtcactgaccgcgccgcccgggccctggcc
gccttcgaagggcgcggccgggtcaccgtcgaggacatccagcgggtgatcgtgctgtgc
ttgcgccaccggttgcgcaaagatccgctcgaatcgatcgactcgggctacaaagtcgaa
aaagtcttccgacgcatcttcgacttgcccccccccgagaccaacgccgcccagtag

DBGET integrated database retrieval system