KEGG   Gloeobacter violaceus: gvip275Help
Entry
gvip275           CDS       T00148                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gvi  Gloeobacter violaceus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    gvip275 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    gvip275 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    gvip275 (thrC)
Enzymes [BR:gvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     gvip275 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2213298..2214587)
Genome map
AA seq 429 aa AA seqDB search
MTQTPLRITTLKGLRCRECGEQYPAEARHVCEFCFGPLEALYDYEAIRGCTSRKTIEAGP
RSIWRYRPFLPVVGERVIDVGTGLTPLIRSERLARRLGLGALYIKNDAVNVPSLSFKDRV
VSVALTRARELGFTTVSCASTGNLANATAAIAAHAGLECYVFIPADLEAGKVLGTLIYGP
QVMAVEGNYDQVNRLCSEVADRHGWGFVNINLRPYYSEGSKTLGFEVAEQLGWRLPDHVV
APVASGSLYTKIYKGFQELIKTGLVGERPVRMSGAQATGCSPVAQAFKAGRDFIAPVKPA
TIAKSIAIGNPADGVYALDLARRTGGHIEDVTDAEIIEGIKLLAQTEGIFTETAGGTTVA
VLKKLVEQGKIAPDELTVVYITGNGLKTQEAIAPYAGETLKIEANLASFERALERARTLD
RLDWQQTLV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacccagacgcccctgcgcatcaccaccttgaagggcttgcgctgccgggaatgcggc
gaacagtacccggccgaagcccggcacgtctgtgaattttgtttcggtccgctcgaagcg
ctctacgactatgaagccatccgcgggtgcaccagccgcaagaccatcgaggcggggccg
cgctcgatctggcgctaccggccgtttttgccggtggtgggtgaacgggtgatcgacgtg
ggaacggggctcacgccgctgattcgctccgagcgcttggcaaggcgcctgggtctgggg
gcgctttacatcaagaacgacgcggtgaacgtgccgagtttgagctttaaagaccgggtg
gtttcggtggcgctcacgcgggcgcgcgagctgggctttacgaccgtttcgtgcgcttcg
accggcaacctggccaacgccaccgcggcgatcgccgcccacgcgggtctcgagtgctat
gtcttcatcccagcggatctggaggcgggcaaggtgttgggcacgctcatctacgggccg
caggtgatggcggtggagggcaactacgaccaggtcaaccgcctgtgctcggaggtggcg
gaccgccacggctgggggtttgtgaacatcaatttgcgcccctattattcagaaggctcc
aagaccctgggttttgaggtggccgagcagttgggctggcgcctgcccgatcacgttgtg
gcgccggtggcctccggatcgctctatacgaaaatctacaagggttttcaggaattgatc
aaaaccggtctggttggggagcggcccgtgcgcatgagcggggcgcaggcgacgggctgc
tcgccggtggcccaggcgtttaaggccggacgcgactttatcgctccggtcaagcccgcc
accatcgccaagtcgatcgccatcggcaaccccgccgacggcgtttatgccctggatctg
gcccgccgcaccggcggacacatcgaagacgtcaccgatgccgaaatcatcgagggcatc
aagctcctggcgcagaccgagggcattttcaccgagaccgccgggggcacgaccgtggcg
gtgctcaagaaactggtcgaacagggcaaaatcgcccccgacgagttgaccgtggtctac
atcaccggcaacggcctcaagacccaagaagcaattgccccctacgcgggcgagaccctg
aaaatcgaggcgaatctggcgagcttcgagcgcgccctggagcgcgcccgtaccctcgac
cgcctcgactggcaacagacccttgtttag

DBGET integrated database retrieval system