KEGG   Gloeobacter violaceus: gvip361Help
Entry
gvip361           CDS       T00148                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00260  Glycine, serine and threonine metabolism
gvi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gvi01100  Metabolic pathways
gvi01110  Biosynthesis of secondary metabolites
gvi01130  Biosynthesis of antibiotics
gvi01230  Biosynthesis of amino acids
Module
gvi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    gvip361 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    gvip361 (trpA)
Enzymes [BR:gvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     gvip361 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB NanE TMP-TENI ThiG FMN_dh DUF2574
Motif
Other DBs
NCBI-GeneID: 2601013
NCBI-ProteinID: NP_925558
UniProt: Q7NHC5
Position
complement(2766779..2767609)
Genome map
AA seq 276 aa AA seqDB search
MSSLASPGRIARVFAALHARREVAFIPFITAGDPDLETTAEALLTLDRNGADLLELGLPY
SDPLADGPTIQAAATRALARGTTPGAVLDLVARLTPELRAPLIVFTYFNLILAVGIEAFV
ERLAASGASGLLVPDLPVEEGDALQTAANVQGLDVIWLVAPTSPPERLRRIAERTTGFVY
LVSTTGVTGARTQVASSVRTSLAQLRALTTRPVAVGFGISTPEQAHEVASLGADGVIVGS
ACVQLLATAAPEERLGQLAEFCRQLKKASQTLPVKS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtctcgcttcccccggccgcatcgcccgcgtttttgccgccttgcacgcgcgg
cgggaagtcgcctttatcccgtttatcaccgcgggagacccggatctggagaccaccgcc
gaggcgctgctcaccctcgaccgcaacggtgccgatctgctggaattgggcctgccttac
tccgatccgctcgccgacggaccgaccatccaggcggcggccacccgcgccctcgcccgg
ggcaccacccccggcgccgtgttggatctggtggcccgcctcacccccgagttgcgcgca
ccgctgattgtcttcacctacttcaacttgatcctggcggtgggaatcgaagcatttgtc
gagcggctcgccgccagtggcgccagcggcctgctggtgccggatctgcccgtcgaagaa
ggcgatgcgctccagacggccgcgaacgtccaggggctcgacgtcatctggctggtggca
ccgaccagcccccccgagcggctcagacggatcgccgagcgcaccaccggctttgtctat
ctggtgagcaccaccggggtgaccggcgcgcgcacccaggtcgcctcctcggtgcgcacg
tccctcgcccagttgcgcgccctcaccacccgtccggtggccgtgggttttggcatctcc
actcctgagcaagcccacgaagtggcttccctgggcgccgacggcgtcattgtcggttcc
gcctgcgtgcaactgctggccaccgctgccccggaagagcgcctcgggcagctcgctgag
ttctgtcgccaattgaaaaaggccagtcaaactcttcctgtaaaaagttaa

DBGET integrated database retrieval system