KEGG   Gloeobacter violaceus: gvip381Help
Entry
gvip381           CDS       T00148                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gvi  Gloeobacter violaceus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    gvip381 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    gvip381 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    gvip381 (trpB)
Enzymes [BR:gvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     gvip381 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2937548..2938792
Genome map
AA seq 414 aa AA seqDB search
MSFTIQTVTFTAPQPLGALPDSRGRFGRFGGQYVPETLMSALAQLEAAFNQYRHDPQFLA
EFAGHLRDFVGRPTPLYFAERLTAHWGGGRIFLKREDLNHTGAHKINNALGQALLALRMG
KRRIIAETGAGQHGVATATVCARFGLECIIYMGVHDIERQKLNVYRMKLLGAEVRPVAAG
TGTLKDATSEAIRDWVTHVETTHYILGSAAGPHPYPLMVREFQAVIGRETRVQCLERLGR
LPDVLIACVGGGSNAIGLFHDFLDERAVRLVGIEAAGEGIETGKHAATLTAGRAGVLHGA
MSYVLQDEQGQVQEAHSLSAGLDYPGVGPEHSYLKDIGRAEYYSVTDSEALAALSLVCST
EGIIPALETAHAFAYLGILASQLHSEQIVVLNCSGRGDKDMGTVARAMGWGKEE
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctttacaatacagaccgtgacttttactgcccctcaacccctgggcgccctgccg
gacagtcggggccgcttcggccgcttcggcggccagtatgtccccgagacgctcatgagc
gccctggcgcaactggaagccgcgttcaatcagtataggcacgatccgcaatttctcgcc
gagttcgcgggccatctgcgcgactttgtcggccggccgacgccgctgtattttgccgag
cgcctcaccgcccactggggcggggggcgcatttttctcaagcgcgaagatctcaaccac
accggcgcccacaagatcaacaatgccctcggacaggcactgttggcgttgcgcatgggc
aagcgccggatcatcgccgagaccggcgccggtcagcatggggtggcgacggccacggtc
tgtgcccgctttggcctggagtgcattatctatatgggtgtgcacgacatcgagcgccaa
aagctcaacgtctaccgcatgaagctgttgggagccgaggtgcgtccggtggccgcgggc
acgggcaccctcaaagacgccacctccgaggcgatccgcgactgggtcacccacgtcgaa
accacccactacatcctgggttccgccgccggtccccatccgtaccctttgatggtgcgc
gaattccaggcggtgattggccgcgagacccgcgtccagtgcctggagcgccttggccgt
ctgcccgatgtgctgattgcctgcgtaggcggcggctccaacgccatcgggctatttcac
gattttttggatgaacgggcggtgcgcctggtgggcatcgaggcggcgggcgaagggatc
gagaccggcaaacacgccgccaccctcaccgccggccgggcgggggtcctgcacggggcg
atgagctatgtgcttcaagacgagcagggccaggtgcaagaagcccattccctcagtgcc
gggctcgattacccgggcgtcggccccgagcacagctatctcaaagacatcggccgcgcc
gagtactacagcgtcaccgacagcgaagcgctcgcggccctctccctggtgtgctccacc
gagggaatcatccctgccctggagacggcccatgcctttgcttacctgggtatcctcgcc
tcccaactgcattcggagcaaatcgtcgtgctcaactgctcggggcgcggcgacaaggac
atgggcaccgtcgcccgtgccatgggctggggcaaggaggagtaa

DBGET integrated database retrieval system