KEGG   Gloeobacter violaceus: gvip394Help
Entry
gvip394           CDS       T00148                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gvi  Gloeobacter violaceus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    gvip394 (ruvA)
Enzymes [BR:gvi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     gvip394 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3074872..3075492
Genome map
AA seq 206 aa AA seqDB search
MITFVRGMLAEVGPRSGQSWATVDVGGVGYRVWTHARTVGKLPRIGEEVKLFTLMIVRED
AMQLFGFLEPGERELFGQLVSVSGIGPRMGLALLETLAPTELVQAILQGNTRALALAPGV
GAKTAQRLALELRSRLSKWREESGLSAMGARASSRVYEEVELALLALGFAPGEVVRALDA
VAPAMAGEEQTEAWLRAAIAWLSEQG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacttttgtgcgcggcatgctcgcggaggtgggtccgcgcagtggccagagttgg
gcgaccgtggatgtgggcggtgtgggttaccgggtgtggacccacgcgcgcaccgtcggc
aaattgccccgcatcggcgaagaggtcaaactcttcaccctgatgatcgtgcgcgaggat
gccatgcagctgttcggctttttggaacccggcgagcgcgaactgttcggccagctggtc
tctgtgagcggcatcggaccgcgcatgggcctggcgctgctggagacgctcgctccgacc
gaactggtgcaggcgattttgcagggcaacacccgcgccctcgcccttgccccgggcgtc
ggtgccaagaccgcccagcgcctggctctggagttgcgctcgcgcctctcgaagtggcgc
gaggagtcggggttgagtgctatgggtgcccgcgcctcctcgcgcgtctacgaagaagtc
gagctggcgctgttggccctgggcttcgcgccgggcgaagtcgtgcgcgccctcgatgcg
gtcgccccggcgatggcgggcgaggagcagaccgaagcctggctcagggccgccatcgcc
tggctttcggagcagggctga

DBGET integrated database retrieval system