KEGG   Gloeobacter violaceus: gvip458Help
Entry
gvip458           CDS       T00148                                 

Gene name
chlH
Definition
magnesium protoporphyrin chelatase
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
gvi  Gloeobacter violaceus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gvi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3530780..3534448
Genome map
AA seq 1222 aa AA seqDB search
MSVPRLVLISSATALGSLPEALRLLEAEGPLFEVEVFLTHRLQDRSLAAETVLASIAGAR
AVLFDLRGTPEQAVSLVQRARRESEGQAVAFIAVFAGDGAALGLLRMGDFVLQPGGYPPA
ASANGRVGGRHAANWQRCVQYWTHSGSENLANLLRFVAAEYAGVETQPAPPQIYPECGFI
DPASGARYAGYGEYRTAHPPDPQRPTVAVLLYGGTTLAANLAGGGELFAALAEGANVVCF
FADGIRTADALKAHFFEDGRPICDAIVSLLWFRLDGGPLGGDAQKTVNLLGALDVPYYVA
ITSHSREIACWEASKDGLSPVETLATVALAELDGAIDPVMLYGLDPAQQVAPVPGRGEHL
ARRILKRVALTRKANRHKRVAVVLFNYPPGEGTLGTASFLDVFASVENVLVQLRRAGYSL
EVPKAGTLKDLLLGRGLLHNGGFVGSERTARHALRVPLATYLRWYEKLPASLRRDSEQVF
GPPPGDLMVEGTDLLMAGIAFGNVLVAVQPSRGIHEDPAKLHHDESLPAHHQYIAFYRYL
AEADGWGADAVVHVGTHGTFEFLPGKQVALGADSVPDALMGDLPHVYLYHVVNVSEGTIA
RRRSYAQLVSHASPTFVAAGLYGHLLELEELLAEYEEQLRVSPPRARAVLRQMVRISVEH
AVPLAVDEAALQDTSELFDPAPYEAALEALHRELFALKRVAVPLGLHTFGHRLTGEALVD
YLALVARYDRPEAPALPRLLALRSRLDYDRLLDRPGPELENLAHQARVVIERQVLGSDPR
DGDLAESLVYLRWLADQVGCTDESAALIQALAGGYVEPGLGGDPVRTPSTYPTGRNTFQF
DPTKLPTESACERGAEIAEATLRRYRAEHGGYPKAVGVILWGFETCKTLGETVGQILHYI
GVRVDRGRGFAMKPEIVPLAVLARPRIDVTVNICGFFRDLFPHLVQLIDRAFEAVAGLAE
PPEQNFVRRHTLESEGEAGVPRHGRLFGPPPGEYGNRLSSLIETGAWEAETDLARMYLNR
TRYLYGQGACEAPEALERALGRVRLISQVRDSHEFEVTDLDHYYEFFGGMARASQLVGGS
RPAVLIADTTGERIEVKTLPEAVRQGVTSRLFNPRWIDGMLAHGHQGAQQIADRVEYLLG
LDATTASVGTATWGQVARRFVFDAAMRDRLIAANPYAAAEIARQLAQAHGRGYWQATDEE
RTHLETLYGQLEYRLEAAPCSN
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtaccccgtctggtgctcatttcctcagccacggccttgggaagtctgcccgaa
gccttgcggctgctggaagctgaaggtccgctctttgaggtggaagttttcttgacccat
cgccttcaggaccgttcgctggccgccgagaccgtactggcgagcattgcaggggcacgg
gcggtgctgttcgatctgcgcggcacccccgagcaggctgtgtccctggtgcagcgggca
cggcgcgagagcgaagggcaggccgtggctttcattgcggtctttgcgggggatggggcg
gccctgggactgttgcgcatgggcgattttgtcctccagcccggcggctacccgccggcc
gcctccgccaacggccgcgtcggcggtcgccacgccgccaactggcagcgctgcgtccag
tactggacccactcgggatctgagaatctggccaacctgctgcgcttcgtggcggcggaa
tacgccggggtggagacccaaccggcgccgccgcagatctatcccgaatgcgggttcatc
gaccccgcctccggtgcgcgctacgccggttacggcgagtaccgcaccgcccaccccccg
gacccgcagcgacccaccgtggcggtgctgctctacggcggcaccaccctggccgccaac
ctcgcagggggcggcgaactgttcgctgccctggccgagggtgccaatgtcgtgtgcttt
tttgccgacggcatccgcacggcggatgccctcaaggcccacttctttgaggacggccgg
ccgatttgcgatgcgatcgtctcgctgttgtggtttcgcctggatggcggaccgctcggg
ggggatgcccagaagacggtgaacctgctgggtgccctcgatgtgccctactacgtggcg
atcacctcccacagccgcgagatcgcctgctgggaggcgagcaaagacggactgtctccg
gtcgagacgctcgccacggtggcgctcgccgaactggacggggcgatcgatccggtgatg
ctctacggcctcgatcccgctcagcaggtggcaccggtgccggggcgcggcgagcacctg
gcgcggcgcatcctcaagcgtgtcgccctgacgcgcaaggccaatcgccacaagcgcgtc
gccgtagtgctctttaactatccacccggagaaggcaccctcggcaccgcctcgtttctc
gatgtgttcgcctcggtcgaaaacgtgctggtccaactgcggcgggccggctacagcctc
gaggtgcccaaagccgggacactcaaagatctgctgctcggtcgcggcttgttgcacaat
ggcggctttgtcggtagcgagcgcaccgcccgccacgccctgcgggtgccgctggcgacc
tatctgcgctggtacgaaaaactgcccgcctccctgcgccgggacagcgagcaggtcttc
gggccgccgccgggggatctgatggtggagggcaccgacttgctgatggcggggatcgcc
ttcggcaatgtcctggtcgccgtgcagccctcgcggggcatccacgaggatccggccaag
ctccaccacgacgagagcctgcccgcccaccaccagtacatcgccttctaccgctatctg
gcggaggcggacggttggggggcggacgccgtcgtccacgtcggcacccacggcacgttc
gaatttctgccgggcaagcaggtggccctgggggctgattcggttcccgatgcgctgatg
ggcgatctgccccacgtctatctctaccacgtggtcaacgtctccgaagggacgatcgcc
cggcggcgcagctacgcgcagctggtgagccacgcctcgcccaccttcgttgcagcgggc
ctctatggccatttgcttgagctggaggaattgctcgccgagtacgaagagcaactgcgg
gtgagcccgccgcgcgcccgagctgtcctgcggcagatggtccgcatctcggtcgagcac
gccgtgcccctagccgtcgacgaagcggccctgcaggatacctccgagctgttcgatccc
gcaccctacgaagcggccctggaggcgctgcaccgggaactgttcgccctcaagcgggtg
gcggtgccgcttgggttgcataccttcggccaccgtctcaccggagaagccctagtcgat
tatttggcgctggtggcccgctacgaccgcccggaggcgccggccctgccgcggctactg
gcgctgcgctcgcgcctcgactacgaccgtttgctcgaccggcccggccccgaactggag
aacctcgcgcaccaggcgcgggtcgttatcgaacggcaggtgctggggagcgatccccgc
gatggagatctggccgaatcgctggtctatctgcgttggctggccgatcaagtgggttgc
accgacgagagcgcagccttgatccaggccctggcgggggggtacgtcgagccggggctc
gggggcgatccggtgcgcaccccgtccacctaccccaccgggcgcaatacctttcaattc
gatccgaccaaactgcccaccgagagcgcctgcgagcggggagcggagatcgccgaggcg
actttgcggcgctaccgggccgagcacggcggttaccccaaggcggtgggggtaattttg
tggggtttcgagacctgcaagaccctgggcgaaacggtcgggcagattctgcactacatc
ggcgtgcgggtggaccggggtcgcgggtttgccatgaagcccgaaatcgtccccctcgca
gtgctcgcccgcccgcgcatcgatgtcacggtcaatatctgcggcttttttcgcgacctc
tttccccatctggtacagctgatcgaccgggcctttgaggcggtggccgggctggcggag
cctcccgagcagaatttcgtgcgccgccacacgctggagagtgagggtgaggcgggggta
ccgcgccacggccgcttgttcggtccgcccccgggcgagtacggcaaccggctgagcagc
ctgatcgagaccggtgcctgggaagcagaaacggacctggcccggatgtacctgaaccgc
acccgctatctctacggtcaaggggcctgcgaagcgccggaggcgctggagcgcgccctc
gggcgcgtgcggctgatcagccaggtgcgcgacagccacgaatttgaagtcaccgacctc
gatcactattacgaatttttcggcggcatggcccgcgcctcccaactggtgggcggcagc
cgcccggcggtgctcatcgccgacaccaccggcgagcgcatcgaggtgaagaccctcccc
gaggcggtgcgccagggggtgaccagccgcctattcaatccccgctggatcgacggcatg
ctcgcccacggccaccagggcgcccagcaaatcgccgaccgggtcgaatatctgctcggg
ctcgacgcgaccaccgccagcgtcggcaccgccacctggggccaggtggcccgccgcttc
gtcttcgacgccgcgatgcgcgatcgcctgatcgccgccaacccctatgccgcagccgag
atcgcccggcaactggcccaggcccacggccgcggctactggcaggccaccgacgaggag
cgcacccacctcgagactctgtatgggcaactggagtaccgcctggaggcggcgccatgc
agcaattag

DBGET integrated database retrieval system