KEGG   Gloeobacter violaceus: gvip475Help
Entry
gvip475           CDS       T00148                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
gvi  Gloeobacter violaceus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gvi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3707697..3708290
Genome map
AA seq 197 aa AA seqDB search
MYTRPLARLIEHLQRLPGIGPKTAQRLAFHLLRRPKSEALQLAQALVEATEQIGVCSRCF
NLSAEDPCDICRQPGRQGETICVVAEPRDLVAIERTREFKGHYHVLGGLINPMEGIGPEQ
LRIKELLQRVGADTVKEVILAINPSTEGEMTTMYLSKYVKVLGPRVTRIAFGLPVGGDLE
YADEMTLARALEGRREI
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacacccggcccctggcccgactcatcgaacacttgcagcgtctgccgggcatcggc
cccaagacggcccagcgcctggcgtttcatctgttgcgccgccccaagtccgaggcattg
caactggcccaggcccttgtcgaagcgacggagcaaatcggtgtgtgcagccgctgtttt
aatctttctgccgaagacccttgcgacatctgccgccagcccggccgccagggcgagacg
atttgcgtggtggccgagccgcgcgacttggtcgccatcgagcgcacccgcgagttcaag
ggtcactaccacgtcctcggcgggctcatcaaccccatggaaggcatcggtcccgagcag
ttgcgcatcaaagaactgctccagcgcgtcggtgccgatacggtcaaagaggtgatcctc
gccatcaacccgagcactgaaggggagatgacgaccatgtatctgagcaaatacgtcaaa
gtgctcggaccgcgcgtgacgcgcatcgccttcggcctgccggtggggggcgatctcgaa
tatgccgacgagatgaccctggcgcgcgccctcgaaggccgccgcgaaatttag

DBGET integrated database retrieval system