KEGG   Geobacillus sp. WCH70: GWCH70_0015Help
Entry
GWCH70_0015       CDS       T00915                                 

Definition
deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GWCH70_0015
   00240 Pyrimidine metabolism
    GWCH70_0015
Enzymes [BR:gwc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     GWCH70_0015
    2.7.1.76  2'-deoxyadenosine kinase
     GWCH70_0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(23755..24423)
Genome map
AA seq 222 aa AA seqDB search
MNLREKYRIPDNAIITIAGTVGVGKSTMTKALAKALNFRTSFEKVDTNPYLDKFYDNFER
WSFHLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDAHIFAKMHFENGTMTAVDYETYTS
LFQAMVMTPYFPHPDLLIYLEGSFEEVMKRIRERGRPMEQKTPISYWKEMYERYEKWINE
FNACPVLRVNINEYDIVEDEQSIEPIIKKASTIIHEYYRIKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacgtgaaaaatatcgtattccagataacgcgatcattacgattgccggaaca
gtcggtgtcggtaaatcaaccatgacaaaagcattagccaaagcgctaaattttcgcact
tcatttgaaaaagtagatacaaatccatatttagacaagttttatgataattttgaacgt
tggagttttcatttacaaatttattttcttgcggagcggtttaaagaacaaaagcggatg
tttgaatatggcggcggctttgttcaagatcggtctatttacgaagacgcgcatattttt
gcaaaaatgcactttgaaaatggaacaatgacggctgtggattacgaaacatatacaagc
ttatttcaagcgatggtcatgacaccgtatttcccgcatcctgatttgcttatttatttg
gaaggaagttttgaggaagtgatgaagcgcattcgtgagcgcgggcgtccaatggaacag
aaaacacctatatcatattggaaggaaatgtatgaacgttatgagaaatggattaatgaa
tttaacgcttgcccagttcttcgcgtaaacattaacgaatacgatattgtcgaagacgag
cagtccatcgaaccaattattaaaaaagcttcaacgattattcacgagtattatcgtata
aaaaaataa

DBGET integrated database retrieval system