KEGG   Geobacillus sp. WCH70: GWCH70_0074Help
Entry
GWCH70_0074       CDS       T00915                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GWCH70_0074
Enzymes [BR:gwc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     GWCH70_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
86405..86932
Genome map
AA seq 175 aa AA seqDB search
MENYAYIALGSNIGDRLYYLREAVKMLDRHEQISVTAASSIYETEPVGYVNQDKFLNMVI
KIYTTLSPFALLDVTQNIEQKLGRKREIRWGPRTLDLDILLYNHENIETEQLIIPHPRMT
ERAFVMIPLLELNHDIHFPNISERLACLIDRLPDKEGVRVWKQKNGEDVFALFES
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattatgcgtatattgctcttggctctaatatcggtgatcgcctatattacctg
cgggaagctgtcaaaatgttggatagacatgaacaaatttccgtcactgctgcttcatct
atttatgagacggaaccggtcggttatgtgaatcaagataagtttttaaatatggttata
aaaatttatacaactctttctccttttgcattgctagacgtcacgcaaaatatcgaacaa
aaacttgggagaaaaagggaaatacggtggggaccacgaacgttagaccttgacatttta
ttatataatcatgaaaatattgaaacagaacaacttatcattcctcatccgcgtatgaca
gagcgggcgtttgttatgattccgttattggaattaaatcacgatatccattttccaaat
atttctgaacgtttagcatgcctcatagatcgactacctgacaaagaaggagttcgtgta
tggaagcagaaaaatggggaagacgtattcgcgcttttcgaaagctga

DBGET integrated database retrieval system