KEGG   Geobacillus sp. WCH70: GWCH70_0143Help
Entry
GWCH70_0143       CDS       T00915                                 

Gene name
truA
Definition
tRNA pseudouridine synthase A (EC:5.4.99.12)
Orthology
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
gwc  Geobacillus sp. WCH70
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
155158..155904
Genome map
AA seq 248 aa AA seqDB search
MSKRIKCTLSYDGTHFFGYQIQPGKRTVQGELERVLEQMHKGKAIRVTASGRTDAGVHAY
GQVIHFDTFLSLSPDQWKKALNAQLPDDIVIKDVQEADPSFHARFSAKAKEYRYKVRIAQ
ERDVFLRNYCYHYPYPLDMEAMRHALRLIEGTHDFTSFCSAKTDVDDRVRTIYKADMAMH
DDLLEFCFIGNGFLYNMVRIIVGTILEVGQGKRSIDSISHAFEAKDRQFAGKTAPPQGLY
LWKVYYDN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacggatcaaatgcacgctttcctatgacggtacacattttttcggttaccaa
attcagcctggcaaacgaacggtgcaaggcgagttagaacgagtgctcgaacaaatgcat
aaagggaaagcgattcgtgttactgcttcaggaaggacagatgcgggtgttcatgcatac
gggcaagtaattcatttcgatacgttcttatcgctttctccagatcaatggaaaaaagca
ttaaatgcccagttaccggatgatatagtgattaaagatgtacaagaagcagatccttct
tttcatgcgcgttttagtgccaaagcaaaagaatatcgatataaagtacgaattgcccaa
gaacgtgacgtatttttacgtaattattgctatcattacccttatccacttgatatggaa
gcgatgagacatgcattgcgacttatagagggcacgcatgactttactagcttttgttca
gcaaagacggatgttgatgatcgtgtacgcacgatttataaagcagatatggcgatgcat
gatgatttattggaattttgctttattggcaacgggtttttatataatatggtgcggatt
atcgttggaacgattttggaagttgggcaaggaaaacggagtatagatagcatctcacac
gcttttgaggcaaaagatcgccagtttgctggcaaaacggctccaccgcaaggattatat
ttatggaaagtatattatgacaactag

DBGET integrated database retrieval system