KEGG   Geobacillus sp. WCH70: GWCH70_0286Help
Entry
GWCH70_0286       CDS       T00915                                 

Gene name
gatC
Definition
aspartyl/glutamyl-tRNA amidotransferase subunit C
Orthology
K02435  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    GWCH70_0286 (gatC)
Enzymes [BR:gwc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GWCH70_0286 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GWCH70_0286 (gatC)
Mitochondrial biogenesis [BR:gwc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GWCH70_0286 (gatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
324303..324593
Genome map
AA seq 96 aa AA seqDB search
MSRISIEQVKHVAHLARLAITDEEAEMFTKQLDAIITFAEQLNELDTENVPPTSHVLDMK
NVMREDVPTPGLPLEEVLKNAPDHQDGQFRVPAILE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagaatttccatagaacaagtaaaacatgtggcgcatttggcgcgtttggcgatt
acggatgaagaagcagaaatgtttacaaagcagttggacgcgattattacattcgctgag
caattaaacgagttggatacagaaaacgttccgccaacatctcatgtacttgatatgaag
aatgtcatgcgcgaagatgtgccaacaccagggctcccgcttgaagaagtgttgaaaaac
gcgccggaccaccaagacgggcaattccgcgtaccagccattttagagtaa

DBGET integrated database retrieval system