KEGG   Geobacillus sp. WCH70: GWCH70_0362Help
Entry
GWCH70_0362       CDS       T00915                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00010  Glycolysis / Gluconeogenesis
gwc00030  Pentose phosphate pathway
gwc00051  Fructose and mannose metabolism
gwc00052  Galactose metabolism
gwc00230  Purine metabolism
gwc00500  Starch and sucrose metabolism
gwc00520  Amino sugar and nucleotide sugar metabolism
gwc00521  Streptomycin biosynthesis
gwc01100  Metabolic pathways
gwc01110  Biosynthesis of secondary metabolites
gwc01120  Microbial metabolism in diverse environments
gwc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWCH70_0362
   00030 Pentose phosphate pathway
    GWCH70_0362
   00051 Fructose and mannose metabolism
    GWCH70_0362
   00052 Galactose metabolism
    GWCH70_0362
   00500 Starch and sucrose metabolism
    GWCH70_0362
   00520 Amino sugar and nucleotide sugar metabolism
    GWCH70_0362
  Nucleotide metabolism
   00230 Purine metabolism
    GWCH70_0362
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GWCH70_0362
Enzymes [BR:gwc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GWCH70_0362
    5.4.2.8  phosphomannomutase
     GWCH70_0362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ACS23287
JGI: GWCH70_0362
UniProt: C5D561
Position
416666..418090
Genome map
AA seq 474 aa AA seqDB search
MSLSMEQRSVLPKHVFKEYDIRGRAGEELDENFAYLLGLAFAEMVRQAGEEKVVVGHDNR
ISSPALHRALIAGLSQASCRVIDIGQVTTPMFYYSLEYTNVPCGMIITASHNPGDENGFK
IAMNKTTIYGERIQELRRTMERILHSQGINRIDTWKEGYVETLDIEPAYLKMLQDKIQLG
PRKLKVVVDCGNGTPSTIAPKALEAWGCEVIPLYCESDPTFPNHHPDPVVPENLKDLIDV
VRREKADLGVAFDGDGDRLGVVDEAGNILWGDQLMILFWREILRSYPGAEAPVEVKCSQA
LVEEIERLGGKPFFHRTGHSHIKATLRSRPEIPFAGEMSGHLFFNDEFYGYDDALYAAGR
LLRILSNDNRKLSQLFADVPRYHATPETRVPCPEEKKAEAIAAVKQRFASSHKVVDVDGA
RIQFKDGWGLVRPSNTQPILVLRAEAKSPETLADIKQQLADVLSKPPLNLTIPW
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagtctttcgatggaacaacgatccgttctaccgaagcacgtgtttaaagagtacgat
attcgcggacgcgcaggagaggagctcgacgagaattttgcctatttgttaggattggcg
tttgcggaaatggtacggcaagccggtgaggagaaagtggtggttggccacgacaaccgc
atctcttcacctgcattacaccgtgcgctgattgcggggcttagccaggcgtcgtgtcgg
gtgattgacatcggtcaggtgacgaccccgatgttctactacagcctcgagtacactaat
gtgccgtgcggcatgatcatcaccgcaagccacaatccaggcgacgaaaacggttttaag
attgcaatgaataagactaccatttatggcgagcgcattcaggaactgcggcggacgatg
gagcggattctccactcacaagggatcaaccgcatcgacacgtggaaggaaggatatgtg
gagacgcttgacatcgaaccagcctatctgaaaatgctgcaagacaagatccagcttggg
ccgcgcaagctcaaggtagtggtcgattgcggcaacgggaccccttcgacgattgcgccg
aaagccttggaggcatggggctgcgaggtcatacctttgtattgcgaatccgatccgaca
ttccctaaccaccatccagatccggtggtgccggagaatttgaaggatttaattgacgtg
gtgcgacgagaaaaggcggatctcggtgtggcattcgatggcgacggtgaccgattggga
gtcgtcgacgaggcaggaaacatcctctggggcgaccaattgatgattttattctggcgt
gagattctccgcagctatccaggagccgaagcgccggttgaggtcaagtgttcgcaggcg
ttggtcgaggaaatcgaacggcttggcggcaaaccgttcttccatcgcactggccattca
catattaaggcgacactgcgcagccggccagagattccgtttgcaggtgaaatgtccgga
catctgttcttcaatgacgagttctacggctatgatgacgccttgtacgcagcggggcgg
ctgttgcgcatactctccaatgataaccgcaagctgtcgcagctatttgccgacgtgccg
cggtatcacgccactccggagacgcgcgtgccttgtccggaagagaagaaggcggaagcc
atcgccgcggtcaaacagcggtttgcaagcagccataaggtcgtggacgtggacggcgcc
cgcattcagttcaaggatggttggggattggtgcgtccgtcgaatacgcagcctatcctt
gttctgcgcgccgaagccaagtcgccggagacattggccgatatcaaacagcagctggct
gacgtactcagcaagccgccgcttaacttgactattccatggtga

DBGET integrated database retrieval system