KEGG   Geobacillus sp. WCH70: GWCH70_0651Help
Entry
GWCH70_0651       CDS       T00915                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00860  Porphyrin and chlorophyll metabolism
gwc01100  Metabolic pathways
gwc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GWCH70_0651
Enzymes [BR:gwc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     GWCH70_0651
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     GWCH70_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Pyr_redox_2 HI0933_like Trp_halogenase Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ACS23544
JGI: GWCH70_0651
UniProt: C5D6M7
Position
712763..714187
Genome map
AA seq 474 aa AA seqDB search
MSGEKRTVVIIGGGITGIAVAYYLQKAIKEQQLPIECKLVEATHRLGGKVQTMIRDGFVI
ERGPDSFLARKTSAFRLVQEVGLEDEIVHNATGKSYILANGKLYPIPGGAVMGIPTQIGP
FITTGLFSPLGKLRAALDFILPPTKTEGDLSLGQFFRRRFGDEVVDNLIEPLLSGIYAGD
IDQMSLMSTFPQFFQLEQRYGSLVRGAKRTTPKAAKQRKGAFQTLKTGLQSLVDELEKRL
EQGSVMKGVRVENVRREGTEYRLRLSNGEVWKADSIIVAIPHSSVPAMFADYPFFAPFQS
VPSTSVATVALAFPESAIEQDIDGTGFVVSRRNDYTITACTWTHKKWPHTAPSGKALLRC
YVGRPGDEEIVEQSDDEIVRVVLDDLNKIMRITGRPEFFVISRWKRAMPQYTVGHKERLA
NIKAHMDSELPGVFLAGSSYEGLGLPDCIAQGEEAVKKVLDYLQVSHRKFAEVN
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggcgaaaaacgtacggttgtgatcatcggaggcggaataacaggaattgccgtt
gcctattatttgcaaaaagcaattaaagaacaacagcttcctattgaatgtaaactggta
gaagcgacccatcgtttaggcggcaaagtgcaaacaatgatacgtgacggttttgtgatt
gagcgcggtcctgattcgtttttagcgcggaaaacaagcgcttttcgtcttgtgcaggaa
gtagggctagaagacgagattgttcataacgcgacaggaaaatcgtacattttagccaac
ggcaagctttatccgataccaggcggagccgtcatggggattccgacacaaatcggtccg
tttatcacgacagggttgttttctccgctgggaaaactgcgtgctgcccttgattttatt
ttgccgccgacaaaaacagaaggcgatttatcattaggacaatttttccgccgccgattt
ggcgatgaggtggtagataacttaattgagccgctgttatctggcatttatgcaggcgat
attgatcaaatgagtttaatgtcgacatttccgcagttctttcaattggagcagcgatac
ggcagcctggtgcgaggtgcaaaacgaacgacgccgaaagcagcaaaacaacggaaaggt
gcgtttcaaacattaaaaacgggattgcaatcgttagtcgatgaattggaaaaacgattg
gaacaaggcagtgtcatgaaaggggtgcgggtagaaaacgttagacgcgaaggaacggaa
tatcgtttgcgtttaagcaatggagaagtgtggaaagcagatagcattatcgtcgcgata
ccgcactcatctgtaccagcgatgtttgctgattatccgtttttcgcgccgtttcaatca
gttccatcgacgtcggtagcaaccgtggcattggcctttccggaaagcgctattgaacaa
gatattgatggaacgggctttgtcgtttcccgccgcaatgattatacgattacggcttgc
acatggacacataaaaaatggccgcataccgcaccaagcggaaaagcgctgttgcgttgc
tatgtcggccgtcctggcgatgaagaaattgtcgaacagtcagatgacgaaatcgtccgc
gtcgtgctggatgatttaaacaaaattatgcgtattacgggacgtccggaatttttcgtt
atttcgcgatggaaaagggcgatgccacaatatacggtaggccataaagagcggcttgcg
aatataaaagcacacatggactctgagcttccaggtgtgtttttagcgggaagttcgtac
gaaggattagggctgccggattgcattgcccaaggggaagaagcggtaaaaaaagtactc
gattatttgcaagtgagccatcgaaagtttgcggaggttaactaa

DBGET integrated database retrieval system