KEGG   Geobacillus sp. WCH70: GWCH70_0665Help
Entry
GWCH70_0665       CDS       T00915                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00630  Glyoxylate and dicarboxylate metabolism
gwc01100  Metabolic pathways
gwc01110  Biosynthesis of secondary metabolites
gwc01120  Microbial metabolism in diverse environments
gwc01200  Carbon metabolism
Module
gwc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GWCH70_0665
Enzymes [BR:gwc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GWCH70_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACS23558
JGI: GWCH70_0665
UniProt: C5D6P1
Position
727161..728447
Genome map
AA seq 428 aa AA seqDB search
MASFEERVKQLEESWKNEERWKGIVRPYSAEDVIKLRGSIDIEYTLARRGAEKLWKLLNT
EDYINALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPSNSVPHVVK
RINQALQRADQIQYLEQSGDIDYFVPIVADAEAGFGGQLNVFELMKAMIEAGAAGVHFED
QLSSEKKCGHLGGKVLLPTQTAVRNLIAARLAADVMGVPTVLIARTDANAADLITSDIDP
RDQEFITGERTPEGFYRTRAGLDQAIARGLAYAPYADLIWCETSEPNLEEARRFAEAIHE
KFPGKMLAYNCSPSFNWKKKLDDETIANFQKELAKMGYKFQFVTLAGFHTLNYSMFELAR
GYKERGMAAYAELQQAEFAAEKYGYTATRHQREVGTGYFDEVAQVISGGQSSTVALKGST
EEEQFTTA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggctagttttgaagaacgcgtaaaacaattggaagaaagttggaaaaatgaagagcgt
tggaaagggattgttcgtccttatagcgcagaagatgtcattaaattgcgcggctcgatt
gatattgaatatacattagctcgtcgcggagcagagaaactttggaaattgttaaatacg
gaagattacatcaatgctcttggggcgttaactggaaaccaagcagttcagcaagtgaaa
gccggtttaaaagcaatttatttaagcggatggcaagtagcggcagatgcaaaccttgca
gggcaaatgtatccagaccaaagcttatatccgtccaatagcgtacctcatgtggtgaaa
cggattaatcaagcattgcaacgtgccgatcaaattcaatatttggaacaaagcggagat
atcgattatttcgtaccgattgttgcggacgcagaagcaggttttggtggtcaattaaat
gtgtttgaattgatgaaagcgatgattgaagcaggtgcagcaggtgttcacttcgaagac
cagctttcttcggagaaaaaatgcggtcacttaggcggaaaagtgttgcttccaacgcaa
acagcggtacgtaacctaattgcggcacgtcttgcagcagatgtcatgggtgtaccgact
gtgttgattgcacgtacagatgcgaatgcggcggatttaattacgagcgatatcgaccct
cgtgaccaagaatttattactggtgaacggacaccggaaggattttaccgcacgagagca
gggcttgaccaagcgattgctcgcggcttagcgtatgcgccgtatgcggatttaatctgg
tgcgaaacaagcgagccaaacttagaagaagcgcgtcgtttcgcagaagcgattcatgaa
aaattcccaggcaaaatgctcgcttacaactgctcgccatcatttaactggaagaaaaaa
ttggatgacgaaacgattgcaaacttccaaaaagaactcgcaaaaatgggctacaaattc
caattcgttacactcgctggtttccatacattaaactacagcatgttcgaattggcacgc
ggatacaaagagcgcggcatggcggcatatgcagaattgcaacaagcagaatttgccgca
gaaaaatatggctacacggcaacaagacatcaacgcgaagtgggtactggttacttcgac
gaagtagcgcaagtgatttccggcggtcaatcatcgacagttgcgttgaaaggttcgaca
gaagaagaacaatttacgacagcataa

DBGET integrated database retrieval system