KEGG   Geobacillus sp. WCH70: GWCH70_0690Help
Entry
GWCH70_0690       CDS       T00915                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GWCH70_0690
Enzymes [BR:gwc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     GWCH70_0690
Peptidases [BR:gwc01002]
 Cysteine Peptidases
  Family C44
   GWCH70_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
756129..757976
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDFQRDLRMEKEIISKMTETLAKRGPDDTNAWFSEHAAFGHKRLIVVDPAGGK
QPMTRMKNGYRYTVCYNGELYNTEDIRKELLKKGYTFQGHSDTEVLLNAYIEWKEHCVDY
FNGIFAFAIWDEQREQLFLARDRLGVKPLFYRHVHDSLLFGSEMKAILAHPEVKAEVDYE
GLAEVFGLGPSRTPGHGVFRGITELRPAHALTFSREGIKVWRYWNVQSDVHRDSLDETVE
KLRFLLIDAVTRQLVSDVPVCTFLSGGVDSSSITAIAAMAFEKEGKGRLHTYSIDYEGND
QYFKANDFQPNADAPWIELMSKTFQTVHHHCVISQEDLFHHLQEAVIVRDVPGMADVDSS
LLWFCKEIRKDFVVSLSGECADEIFGGYPWFHRPDDLARNGFPWMRSTEARMDLLKEDWR
KKLQLDEYVQKRFGETIAEVPRLEGESAEDAKRRELFYLNMIWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYVWNIPWEMKMYGNREKGILRKALEGILPEEVLYRKKSPYPKTHHP
LYTKLVKNWVKELLHDRSSILYEFFDAKKLEELVETEGKSFQAPWFGQLMTGPQLLAYLG
QVHVWFQTYGITIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatcaccggttgggttgattttcagcgcgacttgcgaatggaaaaagagatt
atctctaaaatgacagaaacattagcgaaacgtggacctgacgatacgaatgcttggttt
agcgaacatgccgcatttggacataagcggcttatcgtggtcgacccagcaggcggcaaa
cagccgatgacaagaatgaaaaatgggtatcgttataccgtttgttataacggagaatta
tataatacagaagacattcgtaaagaactattaaaaaaggggtatacattccaagggcat
tcggatacggaagtattattaaacgcttatatagagtggaaagagcactgtgttgattat
tttaacggaatttttgcttttgcgatttgggatgaacagcgcgaacagctatttttagcg
cgggaccgacttggcgtgaagccgcttttttatcggcatgtccatgatagtcttttgttt
ggctcagaaatgaaagcaattttggcacatccggaagtaaaagcagaagtggactatgaa
gggttagcagaagtgtttggattaggtccatcacggacgccaggtcacggagtgtttcgc
ggaattacagaattgcgcccagcgcatgccttaacgttttcccgtgaaggaataaaagta
tggcgctactggaatgttcaaagcgatgtgcatagagattcgttagatgaaacggtagaa
aaactccgttttcttcttatcgatgctgttacgcgccaacttgtttctgatgtgcctgtt
tgtacgtttttatcaggaggggttgattccagttccattactgccattgccgcaatggcg
tttgaaaaagaaggaaaagggcgacttcatacgtattcgattgattatgaagggaacgac
caatatttcaaagcaaatgattttcagccaaatgccgatgcaccttggattgaactaatg
tcaaaaacattccaaaccgtccatcatcattgtgtcattagtcaggaagatttgtttcat
catttacaggaagcggtgatcgtccgtgatgtcccgggcatggcggatgtggactcttcg
ttgctatggttttgcaaagaaataagaaaagattttgtcgttagtttatccggggaatgt
gcggacgaaatttttggcggctacccatggtttcaccgtcctgacgatttagcgcggaac
ggattcccttggatgcgttcgacagaggcacggatggatttattaaaagaagattggaga
aagaaattgcagctggatgaatatgtacaaaagcgctttggtgaaacgatcgcggaggtt
ccaagactggaaggggaaagtgcggaagatgcgaagcggcgcgaattgttttatttgaac
atgatttggtttatgacaacgcttttggatcgaaaagaccgcatgagtatgggcgcgagt
ttggaagttcgcgtgccgtttgccgatcatcggttagtagaatatgtttggaatattcct
tgggagatgaaaatgtacggcaaccgcgaaaaaggcattttgcgcaaggcattggaagga
attttaccagaggaagtgttatatcgcaaaaaaagcccgtatccgaaaacccaccatccg
ctttatacgaagctagtgaaaaattgggtaaaagaattattacatgaccgctcatcgatt
ctttacgaattttttgatgcgaaaaaattagaagaattagtagaaacagaaggaaaatcg
ttccaagcgccttggtttggacagttaatgacaggaccgcaactattggcgtacctcggc
caagtacacgtatggttccaaacgtacggcattacaataaaagaataa

DBGET integrated database retrieval system