KEGG   Geobacillus sp. WCH70: GWCH70_0707Help
Entry
GWCH70_0707       CDS       T00915                                 

Definition
(GenBank) methionine synthase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00270  Cysteine and methionine metabolism
gwc00450  Selenocompound metabolism
gwc00670  One carbon pool by folate
gwc01100  Metabolic pathways
gwc01110  Biosynthesis of secondary metabolites
gwc01230  Biosynthesis of amino acids
Module
gwc_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GWCH70_0707
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    GWCH70_0707
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    GWCH70_0707
Enzymes [BR:gwc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     GWCH70_0707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans Met_synt_B12 Pterin_bind B12-binding_2 B12-binding CdhD His_biosynth Symplekin_C Clathrin_H_link
Motif
Other DBs
NCBI-ProteinID: ACS23598
JGI: GWCH70_0707
UniProt: C5D740
Position
complement(781560..784970)
Genome map
AA seq 1136 aa AA seqDB search
MGNITLEQQLEKKILIIDGAMGTMIQSAKLSADDFGGEAYEGCNEYLTLTAPHVIERIHE
AYLQAGADIIETNTFGATNVVLDEYHLGHLALELNIEAARLARKAADAYSTPEWPRFVAG
SMGPTTKTLSVTGGITFEQLVAAYEEQARGLLLGGVDLLLLETCQDTLNVKAGFIGISKA
FEAVGKQVPIMISGTIEPMGTTLAGQTIESFFISVQHMKPFAVGLNCATGPEFMTDHLRA
LASLANTAVSCYPNAGLPDEEGCYHETPEMLAKKIRRFAEKGWINIVGGCCGTTPEHIRA
IAEAVRDIPPRPIPKSFDVHAVSGIDPLIYDETMRPLFVGERTNVIGSRKFKRLIAEGKY
EEAAEIARAQVKNGAHVIDICLADPDRNEQEDMEKFIQQVVKKVKVPLVIDSTDERVIER
ALTYSQGKAIINSINLEDGEERFEKVIPLLHKYGAAVVVGTIDEQGMAIHAERKLEIALR
SHDLLVNKYGVSPHDIIFDPLVFPVGTGDEQYIGAAKETIEGIRLIKERLPQCLTILGIS
NVSFGLPPVGREILNSVFLYHCTQAGLDYAIVNTEKLERFASIPEEEVRLAEELLFNTND
ETLNTFIQFYRDKTKEPKKIKTELSLEERLAGYVVEGTKEGLYADLEQALQTYSDPLDII
NGPLMEGMDEVGRLFNNNQLIVAEVLQSAEVMKAAVAFLEPYMEKKENSTKGKVLLATVK
GDVHDIGKNLVDIILSNNGFHVIDLGIKVAPQKLIEAVQAEKPDIIGLSGLLVKSAQQMV
VTAQDLRQAGISIPILVGGAALSRKFTENKIAPEYDGIVLYAKDAMEGLALANQLQQNEI
EYTKTKKQETETEKTTPTAIAAKSNVSTDVPVFVPTDLERHILKDISLSHIIPYVNWQMV
LGHHLGLKGKVKRLLEEKDEKALMLKQVVDDLLDEAQRNNWITPAAVYQFFPAQSEGNRI
YIYSPKDKRTIIEMFEFPRQPREPYLCLADYLKSTESGQIDYVGFFAVTAGKGIRELSQR
WKESGEFLKSHAIQALALEIAEGLAELIHQVMRDRWGFPDDPDFTMEQRFAAKYQGQRYS
FGYPACPNLEDQEKLFRLLNPEEIGIHLTDGYMMEPEASVSAIVFAHPEARYFNVL
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacatcacacttgagcaacagctcgaaaaaaaaatattaattattgacggcgca
atgggaacgatgattcaaagcgcgaagctctcagctgatgatttcggcggagaagcatac
gaaggatgcaacgaatatttgacgctcaccgcccctcatgtgatcgagcgcattcatgaa
gcatatttgcaggcgggagcggatattatcgaaacaaacacgttcggtgcgacaaacgtt
gtattagatgaatatcatcttggccatttagcgctagagttaaatatcgaagcagccagg
cttgcccgcaaagccgccgatgcctactctactcccgaatggccgcgctttgtcgctggt
tcgatggggccgacgacaaaaacgttatccgtcacaggaggcattacgttcgaacaatta
gttgccgcttacgaagaacaagcgcgtggactattgcttggcggagtcgacttactttta
ttagaaacgtgccaagacaccttaaacgtcaaagccggctttatcggcatttccaaggcg
tttgaagcggttggaaaacaagtaccgattatgatttccgggacgattgaaccaatggga
acaacattagcaggacaaacgattgaatcgtttttcatctccgtccagcatatgaagccg
ttcgcggtcggattaaactgcgcgaccggccccgagtttatgaccgaccatttgcgcgcg
ctcgcttccttggcgaacactgctgtaagctgctatccgaacgccgggcttccggatgaa
gaaggatgctatcacgagacaccggagatgttagcgaaaaaaatccgacgattcgctgaa
aaaggatggattaacatcgtcggcggctgttgcggaacaaccccggaacatattcgcgcc
atcgccgaagcggtccgggacattccaccgcggccaattccgaaatcttttgacgttcat
gccgtctccggcatcgatccgcttatttacgatgaaacaatgcgtccgctgtttgtcggc
gagcgcacaaacgtaatcggttcgcgcaaatttaaacggctcatcgccgaaggaaaatat
gaagaagcggcggaaattgcccgcgcgcaagtaaaaaacggcgcgcacgtcatcgatatt
tgcttagccgacccggaccgcaacgaacaagaagatatggaaaagtttatccaacaagtc
gtaaaaaaagtaaaagtgccgcttgtcattgattcgacggatgaacgcgttattgaacgc
gctctcacttattcacaagggaaagcaatcattaactcgattaatttggaagacggcgaa
gaacggtttgaaaaagtcattcctctccttcacaaatatggtgctgccgtcgttgtcgga
acgattgatgaacagggaatggcgattcatgctgagcggaagctggaaatcgccttgcgt
tcgcatgacttgctcgtcaacaaatacggagtttccccgcatgacattatttttgacccg
cttgtgttcccggtcggcaccggcgatgaacaatatattggcgcggccaaggaaacgatc
gaaggcatccgtctcattaaagaacggcttccgcaatgtttaacaatacttggcatcagc
aatgtctcattcgggcttccgccggttgggcgggaaattttaaactccgtctttttgtac
cattgcacgcaggccgggctcgattacgcgatcgtcaatacggaaaaattggagcgattc
gcttcgattccggaagaagaagtgcggttggctgaagaactgctgtttaacacgaacgat
gaaacgttaaacacgtttatccaattttaccgcgataaaacgaaagaaccgaaaaaaata
aaaaccgagcttagccttgaggagcggctcgcgggctatgtcgtcgaaggcacgaaagaa
ggattgtacgccgatttggaacaagcgctgcaaacgtattccgacccgcttgacatcatt
aacggaccgctgatggaggggatggatgaagttgggcggctgtttaataacaatcaactc
attgttgccgaagtattacaaagcgcggaagtgatgaaagcagcggtcgcctttttagaa
ccatatatggagaaaaaggaaaacagtacaaaaggaaaagtgcttctcgccactgtcaag
ggcgatgtgcatgacatcggcaaaaacttggtcgacatcattttaagcaacaacggcttt
cacgtcatcgacctaggcattaaagtggcgccgcaaaagctgatcgaagccgttcaagcc
gaaaaaccggatattatcggtttatcagggcttcttgtcaaatccgcccagcaaatggtc
gtcaccgcgcaagatttgcggcaagcgggcatctcgattccgattttagtcggcggtgcg
gcattatcgcgtaaattcacggaaaacaaaatcgctccggaatatgatggaatcgtatta
tacgcaaaagacgccatggaaggactggcgctggcaaatcagctgcagcaaaacgaaatc
gaatatacaaaaacaaaaaagcaagaaacggaaacagaaaaaacgacaccaacggctatt
gcggcaaagtcgaacgtctcgaccgacgttcccgtgtttgtgccaacagatttagaacgc
catatattgaaagatatttcgctttcgcatattattccatacgtcaactggcaaatggta
ttaggacatcaccttgggttaaaaggaaaagtaaaacggctgcttgaggaaaaagatgaa
aaagcgcttatgttaaagcaagtcgtcgatgacctgcttgacgaggcccagcgcaacaac
tggattacgccagcggcggtatatcaatttttcccggcgcaaagtgaaggaaaccggatt
tacatttactcgccaaaagacaaacggaccattatcgaaatgtttgaatttccaagacag
ccaagagagccatacctttgtttagctgattacttgaaatctacagaaagcggacaaatc
gactatgtgggatttttcgccgtcaccgccggaaaaggcattcgcgaactttcgcagcga
tggaaagaaagcggcgaatttttaaaaagtcatgcgattcaagcgctggcgctcgaaatc
gccgaaggattagcggagctcatccaccaagtcatgcgcgaccgctggggctttccggat
gatccggatttcacgatggaacagcgctttgccgcgaaataccaagggcagcgctactcg
ttcggctatccggcttgcccgaacttggaagaccaagaaaagctcttccgtctattgaac
ccagaagaaatcggcatccatttaacggacggatatatgatggagccggaagcttccgtt
tccgcgattgtctttgcccatccagaagcgcgctatttcaatgtgttataa

DBGET integrated database retrieval system