KEGG   Geobacillus sp. WCH70: GWCH70_0853Help
Entry
GWCH70_0853       CDS       T00915                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GWCH70_0853
Enzymes [BR:gwc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     GWCH70_0853
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     GWCH70_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
917673..918215
Genome map
AA seq 180 aa AA seqDB search
MAVIKVRKTGEVIEGEENVRSFLNKQGVLYEHWDINKLPEHLRDKYVLTDEEKEEILATF
KEEIEDLAARRGYKTWDIVALSDATPNLDELLKKFEQVHIHTEDEVRAITAGHGIFIIKG
DSETGYFDVELEAGDVISVPEGNPHYFTLMDDRQVVAVRLFIDPSGWVAHPYEEKEEVGQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaatcaaagtgagaaaaacgggagaagtgattgaaggggaagaaaatgtccgc
agctttttaaacaaacaaggcgtgttgtacgagcattgggacattaacaaactgccggaa
catttgcgcgacaaatatgtattgaccgacgaagaaaaagaggaaattttggcaacgttt
aaagaagaaattgaagatttggcggcgagaagaggctacaaaacttgggatatcgtcgct
ttatcggatgcgacgccgaatttggatgaactgttgaaaaaatttgaacaagtgcacatt
catacggaagacgaggtgcgcgctattactgctggccatggcatttttatcatcaaaggg
gacagcgaaacaggctattttgatgtcgaacttgaagcgggcgatgtcatttccgtgcca
gaaggaaacccgcattatttcaccttaatggatgaccgccaagtcgtcgccgtccgcctg
tttatcgatccgtccggctgggtcgcccatccgtacgaagaaaaagaagaagtaggtcag
taa

DBGET integrated database retrieval system