KEGG   Geobacillus sp. WCH70: GWCH70_0885Help
Entry
GWCH70_0885       CDS       T00915                                 

Definition
alcohol dehydrogenase GroES
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GWCH70_0885
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWCH70_0885
  Lipid metabolism
   00071 Fatty acid degradation
    GWCH70_0885
  Amino acid metabolism
   00350 Tyrosine metabolism
    GWCH70_0885
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GWCH70_0885
   00626 Naphthalene degradation
    GWCH70_0885
Enzymes [BR:gwc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GWCH70_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
946882..947937
Genome map
AA seq 351 aa AA seqDB search
MKAAKIIQHKKPLEILNVPDPKPGPEDAVIKIEACGVCRSDWHAWQGDWSWIGLSPELPI
TPGHEFGGVIEEVGKDVKSFRPGDRVTVPFHSACGRCEYCKKGVPNLCENLQIYGLVSGL
EGGYAEYVLVRNADFNLIRLPENVDSLTAAALGCRYMTGYHGIVRGNVKPGDWVAVHGAG
GVGLSAIQVANALGAQVIAVDIDDQKLEIAKQEGAIAVVNARKENVVEAIKEITKGGAHV
GLDALGIKDTVLNSVLSLRKGGRHVQVGLTTSEEGGFVSLPVDLITASEIEFVGSIGNPH
PDYRGLLSLISSGRLNPKRLVEREIKLEDVNAVFENMSQYNTKGFNVITKF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcgaaaattattcagcacaaaaaaccattggaaattttaaatgtcccggat
cctaaaccagggccggaagatgcggtaataaaaatcgaagcttgcggggtttgccgcagc
gactggcatgcgtggcaaggggattggtcgtggatcggcttgtccccagaattaccgata
acacctggacatgaatttggaggtgtaatcgaagaagttggcaaagatgtgaagtcgttt
cgtccgggagatcgtgtcacagttccgttccattccgcctgtggacgatgtgaatactgc
aaaaaaggtgtgccgaatttatgcgaaaacctccaaatttatggtcttgtttctggactt
gaaggaggatatgcggagtatgtattggttcgcaatgccgattttaacctgatcagactc
cctgaaaatgttgacagtttaacagctgcagctttaggctgccgttacatgactggatat
cacggtattgtcagaggcaatgtcaagcctggtgattgggtggccgtgcatggagctggc
ggagtaggcctttctgcgattcaggtggccaatgcattaggagcgcaagttatagccgtt
gatattgatgatcaaaaacttgaaatcgcaaaacaggaaggcgccattgcggttgtcaat
gccagaaaagaaaacgttgtcgaagcaattaaagaaatcacaaaaggaggcgcgcatgtc
ggactggatgctttaggcatcaaggataccgttcttaattcggttctgtccttaagaaaa
ggaggaagacatgttcaagtaggtttaaccacatcagaagaaggaggttttgtatcgctc
cctgtcgatctgattacggcatctgaaattgagtttgtaggaagtatcggcaatcctcat
cctgactatcgcggcttattgagcttgatttcttccggacgattgaatccgaagcgcttg
gttgaacgtgaaatcaaattggaagatgtaaacgctgtattcgaaaatatgtcacaatat
aatacgaaagggtttaacgtcatcacgaaattttaa

DBGET integrated database retrieval system