KEGG   Geobacillus sp. WCH70: GWCH70_0920Help
Entry
GWCH70_0920       CDS       T00915                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00020  Citrate cycle (TCA cycle)
gwc00310  Lysine degradation
gwc01100  Metabolic pathways
gwc01110  Biosynthesis of secondary metabolites
gwc01120  Microbial metabolism in diverse environments
gwc01130  Biosynthesis of antibiotics
gwc01200  Carbon metabolism
Module
gwc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gwc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GWCH70_0920
  Amino acid metabolism
   00310 Lysine degradation
    GWCH70_0920
Enzymes [BR:gwc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GWCH70_0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N PYNP_C GCV_H
Motif
Other DBs
NCBI-ProteinID: ACS23784
JGI: GWCH70_0920
UniProt: C5D803
Position
981470..982729
Genome map
AA seq 419 aa AA seqDB search
MAEVKVPELAESITEGTIAQWLKKPGDHVEKGESICELETDKVNVEIMAEESGVLQQILA
NEGDTVAVGQAIAVIGEGQEAAPSNQEEPKQATPENLQATNVQAEEIEKQPLSASQPTQR
PIASPAARKIAREKGIDLTQVPTVDPLGRVRKQDVESFAQQQARPQATPATPAQQPAPSV
VKQDDGKPVIREKMSRRRQTIAKRLLEVTQSTAMLTTFNEIDMSAVIELRKRKKDKFFEE
HDVRLGFMSFFVKAAVAALKKYPYVNAEIQGDEIILKKYYDIGVAVSTDEGLVVPVVRDC
DRKNFAEIERDIADLAAKARSNKLSLSDLQGGTFTITNGGVFGSLFSTPLLNGPQVGILG
MHSIKLRPVAIDEERIENRPMMYVALSYDHRIIDGKEAVGFLKTVKDLIENPEDLLLES
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaagtcaaagttccagaattagcagaatctattacggaagggaccattgcacaa
tggttgaaaaaacctggtgatcatgtcgaaaaaggtgaatcgatttgcgaattggaaaca
gataaagtgaatgtagagattatggctgaggaatcaggagtattgcaacaaattttagca
aacgaaggcgatactgtcgcagtaggccaagctattgcggtgatcggcgaaggacaggaa
gctgcgcctagcaatcaagaagaaccaaaacaagcaacaccagaaaacctacaagcgaca
aacgtgcaagcagaggaaatcgaaaaacagccgttatcggctagtcagccgacgcagcgt
ccgattgcttcaccggcagcgcgaaaaatcgcaagggaaaaaggaattgacttaacgcaa
gttcctaccgttgatccgttaggacgggttcgcaaacaagatgtagaatcatttgcacaa
caacaagcaagaccgcaagcaaccccagcaacaccggctcagcagccggctccatcggta
gtgaagcaagatgatggaaagccggtgatccgtgaaaaaatgtcgcgccgccgccagaca
attgctaaacgcttattagaagtgacacaatctacggcgatgttgacaacgtttaatgaa
attgatatgtcggctgtcatagaattacggaaacggaaaaaagataaatttttcgaagaa
catgatgtgcgtcttggatttatgtctttctttgtcaaagcggctgtggcagcactaaaa
aaatatccttacgttaatgcggaaattcaaggtgacgagattattttgaaaaaatactat
gacattggggttgccgtttcaacagatgaaggattagttgttcctgttgtgcgcgactgc
gatcggaaaaactttgccgaaatcgaaagagatattgctgacttggcggcaaaagcgcgc
agcaataaactatcgttaagcgatttgcaaggcggaacgtttaccattacaaacggcggg
gtattcggttcgctcttctccactccgcttcttaacggaccgcaagttggtattttaggc
atgcattctatcaagcttcgtccggttgcgattgacgaagaacgaatcgagaaccgccca
atgatgtatgtggcgctatcgtatgaccatcgaattattgacgggaaagaagcagttggc
tttttaaaaacggtaaaagacttgatcgaaaacccagaagaccttctattagaaagctaa

DBGET integrated database retrieval system