KEGG   Geobacillus sp. WCH70: GWCH70_0954Help
Entry
GWCH70_0954       CDS       T00915                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.168)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GWCH70_0954
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWCH70_0954
   00020 Citrate cycle (TCA cycle)
    GWCH70_0954
   00620 Pyruvate metabolism
    GWCH70_0954
Enzymes [BR:gwc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GWCH70_0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1012267..1013580
Genome map
AA seq 437 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEIL
VEEGTVATVGQTLITLDAPGYENMTFKGQEQDEPKQQEKPQEVSKEEKSEAAAKQAEPAK
QQEVDPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKSDIDAFLAGGTAVEQKEEA
PAAKAEEKAAAATAAQQPVVLEGEFPETREKMSGIRRAIAKAMVNSKHTAPHVTLMDEVD
VTKLVAHRKKFKEIAAEKGIKLTFLPYVVKALTSALREFPVLNTSIDDETEEVIHKHYYN
IGIAADTDRGLLVPVIKHADRKPIFALAKEINELAAKAREGKLAPHEMKGASCTITNIGS
AGGQWFTPVINHPEVAILGIGRISEKPIVRDGEIVVAPVLALSLSFDHRMIDGATAQKAL
NHIKRLLNDPELLLMEA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaagttgccggatatcggtgaaggtattcatgaaggggaaatcgtc
aaatggtttgtcaaacctggcgatgaagtaaatgaagatgatgtattgtgtgaagtgcaa
aacgataaagcggttgtagaaatcccgtcccctgtgaaaggtaaagtattagaaatttta
gtagaagaaggaacggttgcaacggttggccaaacgttaatcacattagatgcgcctgga
tatgagaatatgacgtttaaaggccaagaacaagatgagccaaaacagcaggaaaaaccg
caagaagtgtcgaaagaagaaaagagcgaagcggcagctaaacaagcagaaccggctaag
cagcaggaagtggatccaaaccgtcgcgtgatcgcaatgccttccgtgcgcaaatatgcc
cgtgaaaaaggggtcgacatccgtcttgttcaaggtacaggaaaaaatggccgcgtccta
aagagcgatatcgatgcgttccttgctggtggcacggcagtcgagcaaaaagaagaagca
cctgcagcgaaagcagaagaaaaagcagcggcagctactgcggcacaacaaccagttgtg
cttgaaggagaattcccggaaactcgcgagaaaatgagcggtatccgtcgcgcgattgcc
aaagcgatggtcaattcgaaacatacagcaccacacgttacattaatggacgaagtagat
gtgacaaaactggtagcgcatcgcaaaaagttcaaagaaatcgcagcggaaaaaggaatc
aagcttactttcttaccgtatgttgtaaaagctttaacatcggcgttgcgtgagtttcca
gttttaaatacatcgattgatgatgaaacggaagaagtgattcataaacattactacaac
attggtattgctgctgatacagacagaggattgctcgttcctgttattaaacatgcggac
cgcaagccgatctttgcccttgccaaagagattaatgagcttgcagcaaaagcacgtgaa
ggaaaattggctccacatgaaatgaaaggtgcttcttgcacgattacgaatatcggttct
gccggcggccaatggtttactccggtcattaatcatccagaagtagctattcttggcatt
ggacgcatttccgaaaaaccaattgtccgcgacggtgaaatagttgttgctccagtatta
gcattatcattaagctttgaccaccgcatgattgacggtgcaacagcgcaaaaagcatta
aatcacattaaacgtctattaaatgacccagaattattattaatggaggcgtaa

DBGET integrated database retrieval system