KEGG   Geobacillus sp. WCH70: GWCH70_1044Help
Entry
GWCH70_1044       CDS       T00915                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:gwc00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gwc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1094286..1095215
Genome map
AA seq 309 aa AA seqDB search
MAHLFTLSELSVTEIIRLLEDAEQFRKGHFWRPPEPMFIANLFFEPSTRTKCSFEMAERK
LGLHVIPFDADMSSVQKGETLYDTVRTLEAIGVNALVIRHSQDAYFEELRHTVRTPIINA
GDGCGHHPTQSLLDLLTIRQEFGTFAGLTAAIIGDIRHSRVARSNAEVLTRLGAKVLFSS
PEEWKDEANPYGTYVDIDTAVAEADVIMLLRIQHERHAEKMGLTKEQYHERYGLTIKRAK
KMKANSIILHPAPVNRDVEIESSLVESERSRIFKQMENGVYVRMAVLKRAIEEGRMANGN
YFEKWQVVQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcacatttgtttacattatctgaactgtccgtcacggaaattatccgattattagag
gatgcggagcaatttagaaaaggacatttttggcgtccgcctgaaccgatgtttatcgcc
aatttgttttttgaaccaagcacacggacaaaatgcagctttgaaatggcggaacggaaa
ctagggcttcacgtgattccgtttgatgccgatatgtcgagcgtacaaaaaggagaaaca
ttgtacgacacggtccgcacgcttgaggcgatcggggtaaacgcgcttgttattcgtcat
tcgcaagatgcgtattttgaagagcttcgtcatacggtccgcactcccatcattaacgct
ggtgacggctgcgggcatcatccgacgcaatcgctcttagatttgctcaccatccggcag
gagtttggcacatttgccgggctgactgcagcaatcatcggggatattcgtcacagccgc
gtagcccgctctaatgccgaagtgctgacaagactcggagcgaaggtgttattttcgagt
cccgaagaatggaaagatgaagcaaatccatatggtacgtatgtagatattgatacagcg
gtagcggaggcggatgtcatcatgctgctgcgcatccagcatgaacggcacgcggaaaaa
atggggctgacaaaagaacagtatcatgagcgctatggactgacgataaagcgggcgaaa
aagatgaaagcaaacagcattattttgcatccggcgccagtcaatcgcgatgtcgaaatt
gaaagcagccttgttgaatcggaacgctcgcgcatttttaagcaaatggaaaacggagtc
tatgtgcggatggctgtgttaaaacgagcaatcgaagaagggagaatggccaatggcaat
tattttgaaaaatggcaagtcgttcaataa

DBGET integrated database retrieval system