KEGG   Geobacillus sp. WCH70: GWCH70_1058Help
Entry
GWCH70_1058       CDS       T00915                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gwc00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1112008..1112622
Genome map
AA seq 204 aa AA seqDB search
MSERGLLIVLSGPSGVGKGTVRKALFSQPDINLHYSVSVTTRKPREGEVDGVDYFFKTRE
EFEQMIRENKLLEWAEYVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGALQVRKVFPEGLF
IFLAPPSLSELEKRIIARGTESEELIQNRLKAAKEELEMMDAYDYVVENDKVELACERIK
AIVIAEHCRRERVAKRYKKMLGVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagaggattattgattgtgttgtctggaccgtctggcgttggaaaaggaacg
gtgcgaaaagcattgttttcccagccggatattaatttgcattattccgtttccgtaacg
acaaggaaaccgcgggaaggagaagtcgatggtgtcgattacttctttaaaacgcgcgaa
gaatttgagcaaatgattcgtgaaaacaaattgcttgagtgggcagaatacgttggcaat
tactatggaactccaattgattatgtggaaaaaacgttgcaagaaggaaaagatgtgttc
ttggaaattgaagtgcaaggggcgcttcaagtgcgcaaagtgtttccggaaggtcttttt
atcttccttgcccctccaagtttaagcgaattggaaaaacgaattatagcgcgcggtaca
gagtcagaagagctcattcaaaatcgtttgaaagcagcaaaagaagaacttgaaatgatg
gatgcttacgattatgtcgtggaaaacgataaagtcgagctcgcgtgcgagcggattaaa
gcgatcgtgattgctgaacattgccgacgagaacgtgtggcaaaacgctataaaaaaatg
ttgggggtggaataa

DBGET integrated database retrieval system