KEGG   Geobacillus sp. WCH70: GWCH70_1058Help
Entry
GWCH70_1058       CDS       T00915                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GWCH70_1058 (gmk)
Enzymes [BR:gwc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     GWCH70_1058 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1112008..1112622
Genome map
AA seq 204 aa AA seqDB search
MSERGLLIVLSGPSGVGKGTVRKALFSQPDINLHYSVSVTTRKPREGEVDGVDYFFKTRE
EFEQMIRENKLLEWAEYVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGALQVRKVFPEGLF
IFLAPPSLSELEKRIIARGTESEELIQNRLKAAKEELEMMDAYDYVVENDKVELACERIK
AIVIAEHCRRERVAKRYKKMLGVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagaggattattgattgtgttgtctggaccgtctggcgttggaaaaggaacg
gtgcgaaaagcattgttttcccagccggatattaatttgcattattccgtttccgtaacg
acaaggaaaccgcgggaaggagaagtcgatggtgtcgattacttctttaaaacgcgcgaa
gaatttgagcaaatgattcgtgaaaacaaattgcttgagtgggcagaatacgttggcaat
tactatggaactccaattgattatgtggaaaaaacgttgcaagaaggaaaagatgtgttc
ttggaaattgaagtgcaaggggcgcttcaagtgcgcaaagtgtttccggaaggtcttttt
atcttccttgcccctccaagtttaagcgaattggaaaaacgaattatagcgcgcggtaca
gagtcagaagagctcattcaaaatcgtttgaaagcagcaaaagaagaacttgaaatgatg
gatgcttacgattatgtcgtggaaaacgataaagtcgagctcgcgtgcgagcggattaaa
gcgatcgtgattgctgaacattgccgacgagaacgtgtggcaaaacgctataaaaaaatg
ttgggggtggaataa

DBGET integrated database retrieval system