KEGG   Geobacillus sp. WCH70: GWCH70_1365Help
Entry
GWCH70_1365       CDS       T00915                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
gwc  Geobacillus sp. WCH70
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GWCH70_1365
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    GWCH70_1365
Enzymes [BR:gwc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GWCH70_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1436998..1439094
Genome map
AA seq 698 aa AA seqDB search
MLSFYKKITAAVIAVMMLFVPWASPSANAEETTADLIIYQNIPEVDVKINGNQLSLRALH
VHQEGYFTEATEGIRWKSSNKTVAAVDDHGVVTFFGKNGRTFITVTDGKRKDRIAFKVKT
APASQKNSKQNMKVTVVKEKGSRYNIIQKAIDGLTLEEKIGQMLMPDFRNFNGKPVTDML
PEIKELIQKYHLGGIILFRENVVTTEQTAKLVADYQQAAEKFGLLISIDQEGGIVTRLQS
GTNMPGNMALGATRSKELAWKVGHAIGEELHALGINMNLAPVLDVNNNPDNPVIGVRSFG
ENPELVAELGVSYIKGLQDSGVAATAKHFPGHGDTAVDSHLGLPEVSHDRDRLQKVELYP
FQKAMEAGIDAVMTAHVTFPKVDDTKVISQKDGTAISLPATLSYKVLTELMREEMGFDGV
IITDAMNMKAISDHFGPVDAAVRAVQAGADIVLMPVGLEEVANGLKKAVQNGGISQERIN
ASVKRILTLKVKRGIFKQETPPDMQQIIDQALRVVGSQEHKQVEAEAAAKSITLVKNDHV
LPLQTSKVNNLVVVGNTMIASLEKAVRTYVPNAAVIQASAPLNEAQLQKVKEADAVIVGT
YTLNVSGRLPSSPQMKMVQQIFANTDAPVIAIGIRNPYDVMAYPHVDAYLAQYGFQQASF
QAAVDTIFGVNTPTGKLPVTIPSYDGGVLYEYGHGLTY
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcattttacaaaaaaataacggcagcagtgatagcggtgatgatgctttttgtc
ccgtgggcttcgccatcagcgaacgcggaggaaacaacggccgatttaatcatttaccaa
aacattcctgaagtagacgtgaagataaacggaaatcagctttcattgcgggcccttcat
gttcatcaggaaggatatttcaccgaagcaacagaagggataagatggaaatcatccaat
aaaacggtagctgccgttgatgatcatggtgttgttactttcttcggaaaaaacggaaga
acgtttattacggtgacagacggaaaacggaaagaccgcatcgcttttaaggtcaaaacc
gctcctgcatcgcaaaaaaacagcaaacagaacatgaaagtgaccgttgtcaaagaaaag
ggaagccgctataacatcattcaaaaagcgatagatggcttaacgttggaagaaaaaatc
ggccaaatgctgatgccggattttcgcaatttcaatgggaagcctgtcactgatatgctt
ccggaaattaaggaactcatacagaagtatcatcttggcggcatcattttattccgtgaa
aatgtggtgacgacggagcagacggcaaagctcgtcgcggactatcagcaggcagctgaa
aagttcggtttgcttatatcgatagaccaggaaggcggcattgtgacgcggctgcagtca
gggacaaatatgccgggaaatatggcattaggggcgacacgatcgaaagagcttgcctgg
aaagtagggcatgcgattggagaagaattacatgcgctgggaattaacatgaacttggca
cctgtattggacgtaaacaataatccggataatccggtgatcggcgttcgttcgtttgga
gaaaatccagagcttgtcgcggaactaggggtatcttatatcaaaggattgcaagacagc
ggagttgccgctacagccaaacatttcccaggacatggagataccgctgtcgattcccat
cttgggttgccggaagtatcgcacgatcgcgaccggcttcaaaaagtcgaactgtatccg
tttcaaaaagcaatggaagcgggaattgacgcggttatgaccgctcatgtcacattcccg
aaagtcgatgatacaaaggtgatttcgcaaaaagacggcacggcaatttcgcttcctgct
actttgtcgtataaagtgctaaccgagttaatgcgtgaagaaatgggctttgacggtgtc
attattaccgatgcgatgaatatgaaagcgattagcgaccactttggaccggtggatgcg
gcggtaagagcggttcaagctggtgctgatattgtactcatgccggtggggctggaagaa
gtggcaaacggattaaagaaagccgtgcaaaacggtggcatttcgcaagaacgcatcaac
gcctctgtaaagcgaattttaacgttaaaagtgaaacgcggcatttttaaacaagaaaca
ccgcctgatatgcagcaaatcatcgaccaagcattgcgtgttgtcggttcgcaagagcat
aaacaagtggaagccgaggcagcggctaaatcgattacactagtgaaaaacgaccatgta
ttgccgcttcaaacaagcaaagtgaacaatctcgtcgttgtaggaaatacgatgattgca
tcattagagaaagcagtgcgaacctatgttccaaacgcggctgtgatccaagcgtctgct
cctttaaatgaggcgcagctgcaaaaagtgaaagaagcagatgcggtcattgtcggcacg
tatacattgaatgtatcaggaaggctgccttctagcccgcaaatgaaaatggtgcagcaa
attttcgcaaatacggatgctcctgtcatcgcaatcgggattcgcaatccgtatgatgtg
atggcctatccgcatgtggatgcctatcttgcgcagtatggttttcagcaggcaagtttc
caagcggcagtggatacgattttcggagtaaatacaccgactggcaaacttccagtaacc
attccgagttacgatggcggcgtgctgtacgaatacggccatggtctcacttactaa

DBGET integrated database retrieval system