KEGG   Geobacillus sp. WCH70: GWCH70_1526Help
Entry
GWCH70_1526       CDS       T00915                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GWCH70_1526 (hemD)
Enzymes [BR:gwc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GWCH70_1526 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1598742..1599542
Genome map
AA seq 266 aa AA seqDB search
MRGKRIVLCASRKLEEMTTLIEKQGGIAIVRPAQGILFSKEGELEDEIRAVIAMRPDWFI
FTTGIGVETLLEAAERGKVKEEWVKTIQHANVAVRGYKTAAALKKIGVAPVAASDDGTTK
GLIRSLNEYSFAGKKVIVQLHGTTSPTLKEFLEENHAIYTELLPYRHVAPDPEVLEKLYE
EVIHRKVDAVCFTTEVQVRFLFSFVKEQKDIEWFRQSFNEHVIACAVGKVTAEALYEEGI
VRVVAPELERMGAMIVTLSQYFERQS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggcaaacgcatcgtcttatgcgcgtcaagaaaattagaagaaatgacaacactc
attgaaaaacaaggtggaatagcgatcgtgcgcccggcgcaagggatattattttcaaag
gaaggggagctggaagatgaaattcgtgctgttattgcaatgcgcccggactggtttatt
tttacaacaggcataggagtggaaacgttactagaagcggcagagagagggaaagtgaaa
gaggaatgggtgaaaacgattcagcatgcgaacgtagcagttcgggggtataagacggct
gcggcattaaagaaaattggagttgctcctgttgctgccagtgatgatggaacaacaaag
ggacttattcgctcacttaatgaatattcctttgcgggaaaaaaagtgattgtccaattg
cacggaaccacgtctccgacattaaaggagtttttggaagaaaatcatgcgatatatacc
gagctgcttccgtatcgccatgttgccccagatcctgaagtgctcgaaaagctgtacgag
gaagtgattcaccgaaaagtagatgctgtttgttttacgacggaggtgcaagttcgtttt
ttattttcatttgtaaaagaacaaaaagatattgagtggttccggcaatcatttaacgaa
catgttattgcgtgtgcggtcggaaaagttacggctgaagcgctttatgaagaggggatt
gtccgcgttgttgctccggaactagagcggatgggcgcaatgattgttacattgtcgcaa
tatttcgaacgccagtcatag

DBGET integrated database retrieval system