KEGG   Geobacillus sp. WCH70: GWCH70_1528Help
Entry
GWCH70_1528       CDS       T00915                                 

Definition
respiratory nitrate reductase subunit gamma (EC:1.7.99.4)
Orthology
K00374  
nitrate reductase gamma subunit [EC:1.7.99.4]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    GWCH70_1528
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GWCH70_1528
Enzymes [BR:gwc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With other acceptors
    1.7.99.4  nitrate reductase
     GWCH70_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1600280..1600984)
Genome map
AA seq 234 aa AA seqDB search
MLKQFLWVILPYVVLTIFIGGHIWRYQYDQFGWTSKSSEVLEKKQLRLGSLLFHWGILFV
FIGHVMGILIPEAVYETMGISEEAYHLIALAGGIPAGLAALIGLIILTRRRIAVKRVRVT
SSRGDWIALFFLAIVILTGLFSTLLNIDSNGFDYRTTIGPWFRGVLMFRPNPAYMEQVPI
WFQIHIIAALGIFAVWPFTRLVHVFSLPLRYLRRNYVVYRKRMPKQAEQLNNIH
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacaatttctttgggtcattttgccttacgttgtcctaacgatttttatcggc
ggccatatttggcgttatcaatacgatcagtttggctggacgtccaaatcaagcgaagta
ttggaaaaaaagcagttgcgtctcggcagccttcttttccattggggaattttattcgtt
tttatcggacatgtcatgggaattctgattcctgaagccgtttacgaaacgatgggcatt
tcggaagaagcataccacctcattgcccttgctggtggtattccggcaggattggctgct
ctgatcggactaatcattctgacccgccgccgcatagcggtaaagcgcgttagagtaaca
agcagccgtggggattggatcgctctctttttcctcgcgattgtcatcttaaccggactt
ttttctacgctgcttaatatcgattccaacggctttgactatcgaacaacaatcggtcca
tggttccgcggcgtcctaatgttccggccaaacccagcttatatggaacaggtgccaatc
tggtttcaaattcatattatcgcagcattaggcatttttgccgtttggccatttacaaga
ttggtgcacgtgtttagcttgccgctccgttatcttagacgaaactatgtcgtttatcgt
aaacgcatgcctaagcaagcggagcaactaaacaacattcattaa

DBGET integrated database retrieval system