KEGG   Geobacillus sp. WCH70: GWCH70_1913Help
Entry
GWCH70_1913       CDS       T00915                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GWCH70_1913
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GWCH70_1913
   00630 Glyoxylate and dicarboxylate metabolism
    GWCH70_1913
Enzymes [BR:gwc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GWCH70_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1967802..1969985)
Genome map
AA seq 727 aa AA seqDB search
MGEYVKVGNLQVAKLFYEFMNDEVLPGSEVNKEKFWKDFETLIADLTPKNKALLARRDEL
QAKINEWHKEHRGNFDMEKYKAFLTDIGYLEPEVDDFEITTEGVDEEIAVQAGPQLVVPL
TNARYALNAANARWGSLYDALYGTDAISEEDGAERGDSYNPVRGAKVIAYAREFLDQAVP
LKEYSHKDAVQYAVVDGKLVVSVEGGSTTTLKEEEKFIGFQGNPENPTAILLKNNGLHIE
IQIDRNHPVGKTDKAGVKDIYLEAAVTTIMDGEDSVAAVDAEDKVLVYRNLLGLVKGDLT
STFTKGGKTITRALNPDRVYRTADGKEITLPGRSLMFVRNVGHLMTNNTILDANGEEVYE
GIMDAVVTSLIMKHSLLGNTRYLNSRKGSFYIVKPKMHGSEEVAFANELFDRVEDMLGLK
RNTIKIGVMDEERRTTLNLKNCIYQVRDRIIFINTGFLDRTGDEIHTSMEAGPMIRKNDM
KTSVWLQAYEKSNVTIGLAAGFQGRAQIGKGMWAMPDMMAEMLKQKGGQLKAGANTAWVP
SPTAATLHALHYHQVNVAEVQNELRKERKDYRDEILQIPVAVNPQWTPEEIQEELDNNCQ
GILGYVVRWIDQGIGCSKVPDINNIGLMEDRATLRISSQHIANWLHHGICTKEQVLETLK
RMAKVVDEQNAGDPNYRPMAPDYDNSVAFQAACDLIFKGYEQPNGYTEPILHRRRLEAKA
KYAAVQQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgggggaatacgtaaaagtaggaaatcttcaagtagcaaaactattttatgagtttatg
aacgatgaagtacttccgggaagtgaagtgaacaaagaaaagttttggaaagactttgaa
acccttattgcggatttaacgccgaaaaacaaagcgcttcttgcgcgccgcgatgagctt
caagcaaaaatcaatgaatggcataaagagcaccgcggcaattttgatatggaaaaatat
aaagcatttttaacagatatcggttatttagagccagaagtggatgatttcgagattaca
actgaaggagtagacgaggaaatcgctgttcaagcgggtccgcagttggtcgttccgctt
acgaacgcgcgttatgcattaaacgcggcaaacgcccgctggggaagcctttacgatgcc
ttatatggaacggatgcgatcagcgaagaagatggcgcggaacgcggcgattcctacaat
ccagtccgcggggcaaaagtaattgcctatgcgcgcgaatttctcgatcaagccgtacca
ttgaaagaatattctcataaagatgccgttcaatatgcggtagtggatggaaaactagtg
gtatctgttgaaggcggaagcacaacaacgctaaaagaggaagaaaaattcattgggttc
caaggaaatccggaaaatccgacagcaatcttgttaaaaaataacggtcttcacattgaa
attcaaatcgaccgcaaccatcctgtcgggaaaacggataaagcaggggtaaaagatatt
tatttagaagcggccgttacgaccattatggatggtgaagactcggtagcagcggtagat
gcagaagataaagtgctcgtataccgcaatttgctcggccttgtcaaaggggatttgacg
tctacgtttacgaaaggcggaaaaacgattacacgtgcgcttaacccggaccgcgtttat
cgaacagcagatggcaaagaaattacgctgccaggccgttcgcttatgttcgtccgcaac
gttggccatttaatgacgaacaacacgattttggacgcaaacggcgaagaagtatatgaa
ggaattatggatgcggtcgtgacaagtttaattatgaaacattctcttcttggcaacacc
cgttacttaaattctcgcaaaggctcgttctatatcgtaaaaccaaaaatgcatggttcg
gaagaagtcgcgttcgcaaatgagttatttgaccgcgttgaagatatgcttggattgaaa
cgcaacacgattaaaatcggtgtcatggacgaagaacgccgcacgacattgaacttgaaa
aactgcatttatcaagttagagatcgcatcatctttattaacacaggctttttagatcgg
acaggggatgaaatccatacgtcaatggaagccggtccgatgattcgcaaaaatgacatg
aaaacatcggtatggctgcaagcttatgaaaaatcgaatgtaacgatcggcttagctgct
ggattccaagggcgcgcccaaattggaaaaggaatgtgggcaatgccggatatgatggcg
gaaatgctgaagcaaaaaggcggacagctaaaagcaggcgcgaatacggcatgggtgcct
tcgccgacagccgcgacgcttcatgcgctgcattatcatcaagttaatgtggcagaagta
caaaatgaattgcgaaaagaacggaaagattaccgtgatgaaattttacaaatcccagtc
gctgtaaatccacaatggacgccggaagaaattcaagaagagctggataacaactgccaa
ggcatactcggctatgtggtgcgctggatcgatcaaggtatcggatgttcgaaagtgccg
gatattaataatatcgggttaatggaagaccgcgcgacattgcgaatttccagccagcat
attgcaaactggctccatcacggcatttgcacgaaagaacaagtattagaaacattaaaa
cgtatggcgaaagtcgttgacgaacaaaacgctggcgatccgaactatcgtccaatggct
ccggactatgacaactcggttgcattccaagcagcgtgcgatttaatatttaaaggttat
gaacagcctaacggttatacggagccgattttgcatcgccgtcgtttagaagcgaaagca
aaatatgcagctgttcaacaataa

DBGET integrated database retrieval system