KEGG   Geobacillus sp. WCH70: GWCH70_1977Help
Entry
GWCH70_1977       CDS       T00915                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GWCH70_1977
   01230 Biosynthesis of amino acids
    GWCH70_1977
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWCH70_1977
  Energy metabolism
   00680 Methane metabolism
    GWCH70_1977
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GWCH70_1977
Enzymes [BR:gwc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     GWCH70_1977
Exosome [BR:gwc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   GWCH70_1977
  Exosomal proteins of melanoma cells
   GWCH70_1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2038878..2039450)
Genome map
AA seq 190 aa AA seqDB search
MNTNVYLVRHAHSIFTPDERHRPLSERGKQDAKRVAQILNKEQIDVVISSPYARAIETVE
EVAIYHQLPVILVDGFKERKLAAQPVADFEAAMDQLWHNEDFSFQGGESNKEAQRRGVKA
FQDVLDTYSGKNIVIGTHGNIMTLIMNYYDSSYHFAFWQQLSMPDIYRLTFDQAQRLMEV
KRLWEEQEQR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaacgtatatttggtgaggcacgcccactcgatttttacgcctgatgaacgg
caccggccgttatcggagcggggaaaacaagatgctaagcgcgtcgcgcaaatcttgaac
aaagaacaaatcgatgtcgtcatttccagtccgtatgcgcgggcgatcgaaacggtggaa
gaggttgcgatatatcatcagcttcctgttattcttgtagacggatttaaagaacggaag
cttgcggcccagccagtggccgattttgaggcggcgatggatcagctttggcataatgaa
gacttttcttttcagggaggagagtcgaataaagaagcgcagcggcggggagtaaaggcg
tttcaagatgtgctcgatacatatagcggaaaaaacattgtcattggcacacatggcaat
atcatgacattaatcatgaattattacgactcttcttatcattttgccttttggcagcag
ctgtcgatgcccgatatttatcgcctcacgtttgatcaggcgcagcgtctcatggaagta
aaacggttatgggaggagcaggagcagcgatga

DBGET integrated database retrieval system