KEGG   Geobacillus sp. WCH70: GWCH70_2016Help
Entry
GWCH70_2016       CDS       T00915                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00330  Arginine and proline metabolism
gwc00332  Carbapenem biosynthesis
gwc01100  Metabolic pathways
gwc01130  Biosynthesis of antibiotics
gwc01230  Biosynthesis of amino acids
Module
gwc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GWCH70_2016
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    GWCH70_2016
Enzymes [BR:gwc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GWCH70_2016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACS24743
JGI: GWCH70_2016
UniProt: C5D2V1
Position
2076955..2078079
Genome map
AA seq 374 aa AA seqDB search
MKKQRVVVKIGSSSLTDAKGALCHEKLFDHVESIAYMKQLGHEVILITSGAVAAGFGPLG
YPSRPTTTAGKQAAAAVGQGLLMQGYISAFKQFGITTGQILLTREDFYSRERFHNLFSTI
TTLLACGVLPIINENDSVSVEELTFGDNDMLSALVSGFLHADALIILTDINGLYDDNPKT
NPKAKKYAFLPNITDEMIEAAGGSGSAVGTGGMKSKLLAAQKALSFGVSVFVGTGAGKEK
LCDILEGKGDGTYIGAPFHGHMQMRKQWIAYHAPVAGKIEIDEGAETALLQRGKSLLPAG
VTAVYGNFSAMDVVEVVNRKGAVIGRGQVYYSASDLEQIKGLSSNEARKYSINHRPEVIH
RDNWVSLRKESVVK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagcagcgagtcgtcgtgaaaatcggaagcagctcattaacagatgcgaaaggc
gctctttgccatgaaaaacttttcgatcatgtcgaatcgatcgcctatatgaaacaatta
ggccacgaggtcattttaatcacatcgggtgcggtcgccgctggattcggaccgctcggc
tatccgtctaggccgactaccaccgcgggaaaacaagcagcggcagccgtcgggcaaggg
ctgctcatgcaaggctatatttccgcattcaaacagttcggtattacgacaggacaaatt
ttattaacaagagaagatttttatagccgcgaacggtttcataatttattttccacaatc
accacattgctggcgtgcggggttttgccaattattaacgaaaacgactccgtgtccgtc
gaggaattgacgtttggcgacaacgatatgctttccgcgcttgtcagcggctttttgcac
gcggatgcgctcattattttaacggatattaacggactatatgatgataatccgaaaacg
aatccgaaggcgaaaaaatacgcgtttcttccgaatattaccgatgaaatgattgaagcg
gcgggcggcagcggctctgcggtcgggacgggcggcatgaaatcaaagcttctcgccgcg
caaaaagcgctctcgtttggagtaagcgtctttgtcggaacgggtgcggggaaagaaaaa
ctttgcgacattttggaaggaaaaggagacgggacatatatcggcgcgccatttcatgga
catatgcaaatgcgcaagcaatggattgcataccatgcaccggtcgccggaaaaatcgaa
attgacgaaggcgccgaaaccgccctgttgcagcgtggaaaaagtctgcttcccgctggc
gttaccgcggtatatggaaatttttccgccatggatgtcgtcgaggtcgtcaaccgaaaa
ggagccgtcatcggccgcggtcaagtatattactccgctagcgacttagaacaaatcaaa
ggcctttctagcaatgaagcgagaaaatattcgattaaccatcgaccagaagtaatccac
cgcgacaactgggtatcattacgaaaggagagtgtcgtaaaatga

DBGET integrated database retrieval system