KEGG   Geobacillus sp. WCH70: GWCH70_2138Help
Entry
GWCH70_2138       CDS       T00915                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gwc  Geobacillus sp. WCH70
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GWCH70_2138
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GWCH70_2138
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GWCH70_2138
Enzymes [BR:gwc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GWCH70_2138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2204936..2205727)
Genome map
AA seq 263 aa AA seqDB search
MQLLTVTKPMFIPFIVAGDPRPDITIELALTLQEAGADILELGVPYSDPLADGPIIQRAA
KRALRQQMTLKKAIELVPEMRKKGVKIPIILFTYYNPVLQLGEESFFALARKNEVNGILI
PDLPFEESELIRKLGEATGIPLISLVAPTSKKRIEMIASNAQGFLYCVSSLGVTGVRDTL
PETLNDFLTEVKRHSRVPVVVGFGISTSEQVSMLKNYCDGVVIGSALVQKIEQLNDLLQT
EEKKEEALAEFRRYARSLTAPLR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
ttgcagttgctaaccgtaactaaaccgatgtttattccgtttattgtcgccggagatccc
cggccggatataacgatcgaactcgcattgacgcttcaagaagcgggagctgacattctc
gagctaggcgttccgtattccgatccgttagcggacggaccgattattcaacgggcggca
aaaagagcgcttcgccagcaaatgacattaaaaaaagcaattgaattagttccggaaatg
cgaaaaaaaggagtaaaaattccgattattctctttacgtattacaatcctgtgttacaa
ttaggagaagaatccttttttgctttagcgcgaaaaaatgaagtgaacggcattttaatt
ccagatctgccgtttgaagaaagtgagctgattcgtaaactcggtgaagcgacgggaatt
ccgcttatttctctcgtagcaccgacgtcgaaaaaacgaattgaaatgattgcctccaat
gcgcaaggatttttatattgcgtttcatcgctcggtgtgaccggcgtgcgtgatacattg
ccggaaacattaaacgactttttaaccgaagtaaagcggcatagccgcgttcctgtcgtt
gttggatttggcatttcgacaagcgaacaagttagcatgctaaaaaactattgtgacggg
gtcgtcattggcagcgcgcttgttcaaaaaattgaacagcttaacgaccttttgcaaacg
gaagagaaaaaagaggaggcgcttgccgagtttcgccgttacgctcgctcgctaacagca
ccgttgcgataa

DBGET integrated database retrieval system